(data stored in ACNUC30630 zone)

EMBL: CU458896.PE249

CU458896.PE249       Location/Qualifiers
FT   CDS_pept        254052..255923
FT                   /transl_table=11
FT                   /locus_tag="MAB_0252"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q272L7_MYCFV 5e-45"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60352"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFF2"
FT                   /protein_id="CAM60352.1"
FT                   /translation="MRPTISQLRGWNLDALGKAADAARDNARTLDASLDSCDRVFNDAS
FT                   GWYGKTHDAAKIKVDQELDHGREIRNVLNRISDDAEDAARTLKHAKEFTLQDVDGAVSE
FT                   GFTVTDTGEVSHPDAKKAQAAADHQRRIQSGLDELARLDDMYGKKLREAADDLESMRDG
FT                   QHDVTLPSGERVDPDALVDRVSKMSADERAAFLATLSPETVDAMVIANPEVMGNSDGIP
FT                   FDTRIAANEINIRNALSDELQKQPPDQARVNQLQDMLKPMEDPLVTRPADAGPRDFMVD
FT                   RKYVMFSTEGNGRMIEMIGDIKPGVRGVGVIVPGTNTNLNGSGSNHESAVKLAKESGSP
FT                   IFLYLGGDFPQGLDKAADPSYAAAMAPKLVDFGHEVDRAVGQNAPGTPVTYVGHSYGGA
FT                   IVGTAEQMGLRADRILHASSAGTGILPGGYTDPNPNVQRYSMTAPGDPIAIVQSLPRDV
FT                   RLSDVPGVDQIPGIPHNVEGRIGNPLGGLPSATDPDKIPGVTRLDTGYYGEFGKHPNQV
FT                   IVGPDGHGSYWDDPSSDAFHNIAAVIGGGEATGYVERGIQTNYVDINVGDDGNFRAEAW
FT                   DQSRAAAGAQVPGLPWDDPGTIDRRHHPWDNPRVTDHPEHGQKIQVK"
     atgcgcccga ccatcagcca gctgcgtggc tggaatctgg acgcactggg taaggcggcc        60
     gatgcggcgc gcgacaatgc gcggaccctg gatgcctcgc tggactcttg cgacagggtg       120
     ttcaatgacg cctccggctg gtatggcaag acgcacgacg cggcgaagat caaggtagat       180
     caggaactcg atcacggtcg tgagatccgg aacgtcctga accgcatctc cgatgatgcc       240
     gaggacgcag cacgaacgct caagcatgcc aaggagttca ccctccagga tgtggatggc       300
     gcggtctccg agggcttcac ggtgaccgat accggcgagg tgagccaccc ggatgccaag       360
     aaggcacagg cggccgccga ccatcagcgc cggattcagt ccgggctcga cgagctcgcg       420
     cgcctcgatg acatgtacgg caagaagcta cgggaagcag cagacgacct ggaaagcatg       480
     cgcgacggac agcacgatgt gacgctgcct tcaggggaga gggtggaccc ggacgcactg       540
     gtcgaccgcg tctcgaagat gagtgccgac gaacgtgccg ccttcctggc gacgctgtca       600
     ccggaaacgg tggatgcgat ggtgatcgcc aaccccgagg tcatggggaa cagcgacggg       660
     attccgtttg acaccaggat cgcggcgaat gagatcaaca tccgcaacgc gctcagcgac       720
     gaattgcaga agcaaccgcc cgaccaggca agggtcaacc agctgcaaga catgctcaaa       780
     ccgatggaag atccgttggt cacgcggccg gcggatgccg ggccgcgtga cttcatggtg       840
     gaccgcaagt acgtcatgtt ctccaccgaa ggaaacggtc gcatgatcga gatgatcggc       900
     gatatcaagc cgggcgtccg gggtgttggg gtgatcgttc cgggtaccaa caccaatctc       960
     aacggcagcg gttccaacca cgagtctgcg gtcaagctgg ccaaggaaag cggttcgccc      1020
     atcttcttgt acctgggcgg cgactttcca caggggctcg acaaggccgc cgatccctcc      1080
     tacgcggcgg cgatggcgcc caagctggtg gacttcgggc atgaggtgga ccgggcggta      1140
     ggtcagaacg cgccgggtac accggtgaca tacgtggggc actcctacgg cggtgccatc      1200
     gtgggaactg ccgaacagat gggtctgcgc gcagaccgca tcctgcacgc gtcctcggcg      1260
     ggcacgggca tcttgcccgg cggctacacc gatccgaacc ccaacgtgca gcgctactcg      1320
     atgacggcgc ccggcgatcc gatagcgata gtgcaatccc ttccgcgcga tgtgcgtctc      1380
     tcggatgttc ccggcgtgga tcagattccg ggcataccgc acaacgtgga gggaaggatc      1440
     ggcaatccgc tgggtggact gccttcggcg acggatccgg acaagatccc cggtgtcact      1500
     cgactggaca cgggctacta cggcgagttc ggtaagcatc cgaaccaagt cattgtggga      1560
     ccggacggtc acggaagcta ctgggacgac ccgagttcgg atgccttcca caacatcgct      1620
     gcggtgatcg gcggaggtga ggcgacgggc tacgtcgaac ggggcatcca gacgaattac      1680
     gtcgacatca atgtcggcga tgacggcaat ttccgggccg aggcgtggga tcaatcgcgc      1740
     gcggccgccg gcgcgcaggt gcccggcctg ccgtgggatg acccggggac cattgaccgg      1800
     cgccaccacc cgtgggacaa cccacgggtg accgaccacc ccgagcatgg ccagaagatc      1860
     caggtgaaat ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page