(data stored in ACNUC30630 zone)

EMBL: CU458896.PE258

CU458896.PE258       Location/Qualifiers
FT   CDS_pept        263053..263985
FT                   /transl_table=11
FT                   /locus_tag="MAB_0261"
FT                   /product="Probable amino acid ABC transporter, substrate
FT                   binding"
FT                   /note="Similar to Q25Z61_MYCVN e-102"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60361"
FT                   /db_xref="GOA:B1MFG1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFG1"
FT                   /protein_id="CAM60361.1"
FT                   /translation="MRRAAQLLVAVMAAIFFSGCGSANPLGGGPLSGNLNTLIVGSADF
FT                   PESKTVAELYAQILQINGFDVTRQLGIGSRETYIPAVKDHSIDLIADYTGNLLRYFDPE
FT                   ATATKPDEVELALLRKLDGDLDILSPSPAADADTLCVTRATAEKWNLRSIGDLAAHSAE
FT                   VTVGAPSEFLHRSVGLAGLKANYGLDIPESRFVAISDGGGPATVKALVDGTITTANIFS
FT                   TSPAIAEHDLVVLDDPKFTFPAGNLVPLVNAQKKSEKLKKVLDALSARLTTADLTGLNA
FT                   AVSGNNGVDPKEAAQKWLTDKGFDKPVGA"
     atgcgcaggg ccgcacaact gctcgttgcc gtcatggcgg cgattttctt cagcggctgc        60
     ggcagcgcca atcccctggg cggaggcccc ctttcgggta atctgaatac gctgatcgtc       120
     ggctccgcgg acttccccga atcgaagacc gtcgccgagc tatacgcgca gatactgcag       180
     atcaacggct ttgacgtcac caggcagttg ggtatcggta gccgtgaaac gtatatcccg       240
     gcggtcaagg accattcgat cgacctcatt gccgactaca ccggaaatct actgcgctac       300
     tttgacccgg aggccaccgc taccaagccc gatgaagtcg agctcgcgct gctacgcaag       360
     ctcgacggcg atctggacat cttgtcgccc tcgccggccg ctgatgccga cacgctatgc       420
     gtcaccaggg ccaccgcgga gaagtggaat ctgcgctcga tcggcgacct ggcggcgcac       480
     tcggcggagg tcacggtcgg cgcgccctcg gaattcctgc accgcagtgt cgggctggcg       540
     gggctcaagg ccaattatgg actggatatc ccggaatcgc ggttcgtcgc catcagcgat       600
     ggcggcggac cggcgacggt caaggcgctg gtggatggga ccatcaccac ggccaacatc       660
     ttcagcacct caccggccat tgccgagcac gatctggtgg tcttggacga tcccaagttc       720
     acgttcccgg ccggcaatct ggtgccgttg gtcaacgcgc agaagaaatc cgagaaattg       780
     aagaaggtgc tggacgcgct ctcggcgcga ctgaccacgg cggacctcac cggcctcaat       840
     gccgcagtgt ccggcaacaa cggagtcgac cccaaggaag cagcacagaa atggttgacg       900
     gacaagggct tcgacaaacc cgtgggggcg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page