(data stored in ACNUC30630 zone)

EMBL: CU458896.PE268

CU458896.PE268       Location/Qualifiers
FT   CDS_pept        270714..271286
FT                   /transl_table=11
FT                   /locus_tag="MAB_0271"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60371"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFH1"
FT                   /protein_id="CAM60371.1"
FT                   /translation="MIPELTADGHLPPGRYRVTLEAIRDRFVAHEDFAGSSSRARLFGG
FT                   LVEYLIAWEDVQAMTSANGRILKSLWLAGSFTSSVVDPRDVDATPIVNGVVADSVVGRP
FT                   GSKGIKRLIQHRDSIKARYGVEIFPVRWHPIEHPFDPKVDLTGDEAAYLSDRGKMDDWW
FT                   QRCRVNGEDAPTAASCETRRGYLEVIA"
     atgattcctg agctaacggc tgatgggcac ctaccgccgg gacggtatcg cgtcaccctg        60
     gaagctattc gagaccgctt tgtcgctcat gaagactttg cgggaagcag cagtcgagcg       120
     aggctgtttg gcggactcgt cgagtacctc atcgcttggg aggacgttca agcgatgaca       180
     tccgctaacg gtcggattct taagtcgctg tggctcgctg ggagcttcac atcaagtgtc       240
     gttgatccac gtgacgtcga cgcgacgccg atagtgaacg gtgtggttgc tgattccgtg       300
     gtgggccgtc cagggtctaa aggcatcaag cggctgatac agcaccgcga ctccatcaag       360
     gcgcggtatg gggttgagat attccccgtg agatggcatc ctatcgaaca tccgttcgat       420
     ccaaaggtgg acctgactgg cgacgaggct gcatacttat ctgatcgcgg gaagatggac       480
     gactggtggc agcggtgtcg tgtcaacggt gaagatgccc caactgcggc gagctgtgaa       540
     acgcgaagag gttatctgga ggtgatcgca tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page