(data stored in ACNUC30630 zone)

EMBL: CU458896.PE27

CU458896.PE27        Location/Qualifiers
FT   CDS_pept        complement(27424..27849)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0028c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q744S0_MYCPA 7e-20"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0028c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60130"
FT                   /db_xref="GOA:B1ME66"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME66"
FT                   /protein_id="CAM60130.1"
FT                   /translation="MDNSTPPPVEWGPKPAGILAVALLGIALGVASALFVTDAPGRLLA
FT                   ALAALGLLIFAAVSWRCRPKLRLADDGLQMQGLTRHTLLPRTAVDSVKVTEFRRLGRRT
FT                   RLLEIESGDRLIVLNRWDLGTDPRDVHEALRAARYPA"
     gtggataact cgacgccgcc tcccgttgaa tggggcccga aacctgccgg catcctcgcc        60
     gtggcgctcc tcggcatcgc cctcggtgtt gcctcggcgt tgtttgtgac cgatgcaccg       120
     ggacgtctgc tggccgcgct ggcggctctt ggtctgctga tcttcgcggc ggtgtcctgg       180
     cgctgccgcc cgaaactgcg tctcgccgac gacggcctgc agatgcaggg cttgacccgc       240
     cacacgttgc tgccgcgcac tgccgtcgat tcggtaaaag tcaccgagtt ccgccgtctg       300
     ggacggcgca cccggctgtt ggagatcgaa tcgggggaca ggctgatcgt gctgaaccgg       360
     tgggatctgg gtaccgatcc tcgcgacgtg cacgaagcac tgcgcgcagc gcgctatccg       420
     gcgtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page