(data stored in ACNUC30630 zone)

EMBL: CU458896.PE271

CU458896.PE271       Location/Qualifiers
FT   CDS_pept        complement(272701..273252)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0274c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5YRJ1_NOCFA 9e-46"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0274c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60374"
FT                   /db_xref="InterPro:IPR025568"
FT                   /db_xref="InterPro:IPR025951"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFH4"
FT                   /protein_id="CAM60374.1"
FT                   /translation="MTSTSDLFALEHGTTTQEALTFFDNLEPIRAEELIGQRWHGGEVP
FT                   TGHSMDGILTVSGWYGKQFDDVDHVHPLLFSDGGGDIFAVDPMLAPMGLAGRISGLTES
FT                   PMVKRTSPTALSALKPLIRTTKHRARLRNIEFRGAVSAAMVYDHKAIIDHFRKVDDATL
FT                   LGIMDLRDMDQPYFFTLRRD"
     atgacatcga cgtctgatct tttcgcgctg gagcatggga ccaccacgca ggaagcgctg        60
     accttcttcg acaatctgga gcccatccga gccgaggaat tgatcggtca acgatggcac       120
     ggcggcgagg tgcccaccgg gcattcgatg gacggcatcc tgacggtgtc gggctggtac       180
     ggcaagcagt tcgacgatgt ggaccacgtg catccgttgc tcttcagcga tggcgggggc       240
     gatattttcg cggtcgatcc gatgctggcg ccgatgggac tggcgggccg gatcagcgga       300
     ctgaccgagt ccccgatggt caagcggacg tcgccgactg cactatccgc actcaagcca       360
     ctgatcagaa ccaccaaaca ccgcgcccgg ctgcgcaata tcgaattccg cggagccgtc       420
     agcgcggcca tggtctacga ccacaaggcg atcatcgacc acttccgcaa ggtcgatgac       480
     gcgacattgc tgggcatcat ggacctgcgt gatatggacc agccgtactt cttcacgttg       540
     cgccgggact ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page