(data stored in ACNUC30630 zone)

EMBL: CU458896.PE274

CU458896.PE274       Location/Qualifiers
FT   CDS_pept        complement(275879..277324)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0277c"
FT                   /product="Probable amino acid ABC transporter, permease"
FT                   /note="Similar to Q26YH8_MYCFV e-174"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0277c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60377"
FT                   /db_xref="GOA:B1MFH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFH7"
FT                   /protein_id="CAM60377.1"
FT                   /translation="MFRAIVLALLALVAVAGCAAPTQEPLRVGTEGVYAPFSFHDGHTG
FT                   ELTGYDVDVARAVGEKLGRPVEFVEIPWDAIFAGLDAERFDVVANQVTITPARKAKYDI
FT                   STPYAVGEGVIVTRADDNSIHSLSDVRGKVAAENATSNWSQIARDAGARVEAVEGFTQS
FT                   ITLLSQGRVDVVINDSIAVYAYLASTGDPAVKIAGATGQRSEQGFAARKNSGLLPDLDK
FT                   ALDQLAADGTLTRISQKYLKTDASGTTKPQAGKGDSGSTRSDTQLVLDNLWPMARAMIT
FT                   VTLPLTAISFVIGLVIALGVALARMSGHRVVTGLARIYISVIRGTPLLLQLFLIFFALP
FT                   EFGVKISPFPAAVIAFSLNVGGYAAEIIRSSILSIPRGQWEAASSLGMSYSTTLWRIVI
FT                   PQASRVAVPPLSNTLISLVKDTSLASAILVTDVMRTAQVAAAPTFQFFTLYVTAGVYYW
FT                   IVCMAMSAVQDRLEQRLEKSVAR"
     gtgtttcgtg ccatcgtgct tgcgcttctg gcgcttgtgg cggtagccgg atgtgcggcc        60
     ccaacacagg agccgctgcg ggtcggcacc gagggcgtgt acgcgccgtt cagcttccac       120
     gacgggcaca ccggcgagct gacgggttac gacgtggacg tggcccgcgc cgtcggcgag       180
     aagctgggtc gccccgtgga attcgtcgag attccctggg atgcgatctt cgccggattg       240
     gacgcagaac ggttcgacgt cgtcgccaac caagtcacga tcaccccggc gcgcaaggca       300
     aagtacgaca tttccacacc gtacgcagtg ggcgagggtg tgatcgtgac gcgggccgac       360
     gacaacagca ttcacagcct gtccgatgta cggggcaagg tggccgccga gaacgcgacc       420
     agtaattggt cgcagatcgc ccgcgacgcc ggcgcccgcg ttgaggcggt ggagggcttc       480
     acccaatcca tcacactgct cagccagggt cgggtagacg tcgtcatcaa cgacagcatc       540
     gccgtctatg cctacctggc cagcaccggt gaccctgcgg tgaagatcgc cggggccacc       600
     ggccagcgca gcgagcaggg gttcgccgca cgcaagaaca gcggcctgct gccggacctg       660
     gacaaggcgc tggatcagtt ggcggccgat gggacgctca cccgcatctc tcagaagtac       720
     ctcaagacgg acgccagcgg gactaccaaa ccacaagccg ggaagggaga ttccggcagt       780
     acgcggtccg acacccagct ggtgctggac aacctgtggc ccatggcccg agccatgatc       840
     accgtcacgc tgccgctgac cgccatcagc ttcgtgatcg gactggtgat cgccctcggg       900
     gtcgcactgg cccgcatgtc cggtcatcgc gtggtgaccg gcctcgcccg catctacatc       960
     tctgtcatcc gtggcacgcc gctgctgctg cagctgtttc tcatcttctt cgcgctgccc      1020
     gaattcgggg tcaagatcag tccctttcct gccgccgtca tcgcgttcag tctcaacgtg      1080
     ggcggctacg ccgccgaaat cattcgttcg tccatcctga gcatcccccg cgggcagtgg      1140
     gaggcggcct ccagcctggg gatgagctac agcaccacgt tgtggcggat cgtcattccg      1200
     caggccagcc gggtggcggt gcccccgctg tcgaacacct tgatctccct ggtgaaggac      1260
     acctcgctgg cctcggcgat cctggtgacg gacgtgatgc gtacggcaca ggtcgccgcc      1320
     gcgccgacct ttcagttctt cacgctctac gtcaccgccg gcgtctacta ctggattgtc      1380
     tgcatggcga tgtcggcggt gcaggaccgg ctggagcagc gtctggagaa atccgtcgcg      1440
     cgctaa                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page