(data stored in ACNUC30630 zone)

EMBL: CU458896.PE288

CU458896.PE288       Location/Qualifiers
FT   CDS_pept        291987..293840
FT                   /transl_table=11
FT                   /locus_tag="MAB_0291"
FT                   /product="Conserved hypothetical protein (transcriptional
FT                   regulator CdaR?)"
FT                   /note="Similar to Q00509_STRAM 1e-63"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60391"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFJ1"
FT                   /protein_id="CAM60391.1"
FT                   /translation="MTDIQVGGAREGVPSAGPSALSVLRLLASGTAPDVFEARLKEMAR
FT                   ESSPPWSAADLHRARGYAERIYGLIEGQNQREARLSNLVGIGIDLLGCHGLDEASTTLV
FT                   KRARIMLDADFSFISVRDDSEPETRHHVRYVDGPTTAINHGLYFPIGDDVGLVSLYRPG
FT                   QGPVWTADYPSDTRFSRASDGDAAMRSEGVHSLMVMPMEHEDQHFGNLYVGSRTVRSFS
FT                   AAERSLFASLCSFAGIALARASEFSSNTEQISALERRLELRSILLDTGAGPGGMDGFVL
FT                   TAGEQLGVAMRVTGHDGSEIASYKWEPDTQNILTTALTVGDDYHGELSVASLDDQPVSV
FT                   YPLKIEDLATTAAVVMCGDNRMSLSVSQLRNDLLHDVLDYRQRDSRLVQIYARRLALDL
FT                   NQPHVVVIVRPERGGLDRASLWSASFASRVGGLRATQDEVVVLLIPGSDAGRIAQTVWD
FT                   ETTAHLRMPVTVSSAGPSERIESIEDTYQDAMRCLDAMSALGALGTAAAAHELGFLGVL
FT                   LSRHQDVEGFVRSMVGPVIDYDEDRDTDLLQTLDVYFSVGASPTRAAKILHTHPNTVVR
FT                   RLDRVNELLGDGWQDAERLLDTQLAIKLWKVRGSLLTRQTG"
     ttgactgaca ttcaggtggg cggggcgcgc gagggggttc ccagcgcggg cccctcagcg        60
     ctatccgtgc tgcggctact cgcgtcgggg acggctcccg acgtgttcga ggcccgtctg       120
     aaggaaatgg cacgggaatc ctcgccgccg tggagcgccg ccgacctgca ccgtgcccgc       180
     ggatacgctg agcgcattta tggtctcatc gaagggcaaa accagcgcga ggcgcgtctt       240
     tccaacctgg tcggcatcgg catcgactta ctcggctgcc acggcctcga cgaggcgtcc       300
     acgacattgg tcaaacgcgc acggatcatg ctcgacgccg atttctcgtt catctcggtg       360
     cgcgatgatt cggagccgga gacgcggcat cacgtccggt acgtcgatgg gcccacgacc       420
     gcgataaacc acgggctcta cttcccgatc ggtgacgacg tcgggctggt cagtttgtac       480
     cggccggggc aagggccggt ctggacagcg gattacccgt ccgacaccag gttcagccgt       540
     gccagcgatg gtgatgccgc catgcgttcg gagggcgtac acagcttgat ggttatgccg       600
     atggagcatg aggatcagca cttcggcaac ctgtacgttg gatcacgcac ggtgcgcagc       660
     ttcagcgccg ccgagcggtc cttgtttgcg agcctgtgtt cgttcgcggg catcgcactg       720
     gcacgggcca gcgaattctc cagtaacaca gaacaaatca gcgctctgga gcgtcgtctt       780
     gagctgcggt ccatacttct ggataccggg gccggcccgg gtggcatgga cggcttcgta       840
     ctcaccgcag gcgaacagct cggcgtcgcg atgcgtgtga ccgggcacga tggatccgag       900
     atcgcctcct acaaatggga gcctgacaca cagaatatcc tgaccactgc cttgaccgtg       960
     ggcgacgact atcacggcga gctatccgtg gccagtctcg acgaccagcc agtttcggtg      1020
     tacccattga agattgagga tcttgccact actgccgcgg tggtcatgtg cggtgacaac      1080
     cggatgtcgc tgtcggtctc gcagctgcgt aacgacctgc tgcatgacgt gttggactac      1140
     cgccagcgcg acagccgatt ggttcagata tacgcccggc gtttggcttt ggatctcaac      1200
     caaccacatg tcgtggtcat cgtgaggcca gaacgcgggg ggctggatcg tgcgtcgctg      1260
     tggtcggcgt cattcgcctc acgggtgggc gggctgcggg ccactcagga cgaggtggtg      1320
     gtgctgctca tcccgggatc ggacgcgggg cgcatcgctc agacagtgtg ggacgaaacc      1380
     accgcacatc tgcggatgcc ggtcacggtg tcttccgccg gaccgtcgga acggatcgag      1440
     tccatcgagg acacctatca ggacgcgatg cgttgtctgg atgcgatgag tgcactgggt      1500
     gcactcggaa cagcggctgc tgcacatgaa ctcggcttct tgggggtgct gttatcgcgc      1560
     caccaggatg tggagggttt tgtgagatcg atggtcgggc ccgtcatcga ttacgacgag      1620
     gaccgcgaca ccgatctgct tcagacactc gacgtgtact tctccgtcgg cgccagcccc      1680
     acccgggcag cgaagatcct gcacacacac cccaacacgg tggtgcgccg tcttgaccgg      1740
     gtgaacgaac tactgggtga cgggtggcag gacgccgagc gcctcttgga cacgcagctc      1800
     gccatcaagc tgtggaaagt gagaggctcg ctgctcactc gccagaccgg gtga            1854
//

If you have problems or comments...

PBIL Back to PBIL home page