(data stored in ACNUC30630 zone)

EMBL: CU458896.PE311

CU458896.PE311       Location/Qualifiers
FT   CDS_pept        317998..319191
FT                   /transl_table=11
FT                   /locus_tag="MAB_0315"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q73YD4_MYCPA 2e-63"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60414"
FT                   /db_xref="GOA:B1MFL4"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFL4"
FT                   /protein_id="CAM60414.1"
FT                   /translation="MTSSTAVQPDAVQRARELAPAIAARALEAERLRRMPDETIAELSR
FT                   SGLFSLMAPRRYGGDEASLETLVGAVIEVGKVCGSTAWTFCIYGIHNWLAGLFPEQLQD
FT                   EMFGSVPAGSPLLFPGSWSPSGIATPVEGGYKITGRWQFGSGVWHSSWASVAAVVQHEE
FT                   PPKYPDLRTFMIPRSDLEVIDTWFTSGLRGTGSMDIAVNDVFVPEHRVQEFGPLARGQS
FT                   PSAELHGSAIYRIPLFCALSNVAAAPAVGMALGTVELFTEKIKTRVMRYSMQEQSKLAT
FT                   AHRRMGHVAAQAESARTLLLQTVRDVEDKLRSGEGLTTGDRVAVRRNCAYIVEVCKQAI
FT                   GEAVEACGASAQYEDSPLQRHLRDVNTLSTHVVYDTDSAYELYGRVELGLPPGSVAF"
     atgacgagtt cgacagcagt gcagccagat gccgtacagc gtgcgcgtga gctcgctccg        60
     gcgatcgcag cccgggcgct ggaggccgag cggctgcgtc gaatgcccga tgagaccatc       120
     gccgagttgt cgcgatcggg actgttcagt ttgatggcgc cgcggcgata cggtggcgat       180
     gaggcaagcc tggagacctt ggtcggtgcg gtcatcgagg tgggcaaggt ctgtggatcg       240
     accgcctgga ccttctgtat ctacgggatt cacaactggc tggccggact gtttcccgaa       300
     cagttgcagg acgagatgtt cggctcggtg cccgccggct ctcccttgct gtttccgggc       360
     agctggtcgc cctcgggtat cgccaccccg gtcgagggcg gctacaagat aacggggcgt       420
     tggcaattcg gcagtggtgt ctggcactcg tcgtgggcgt ccgtcgcggc agtcgtccaa       480
     cacgaggagc cgccgaagta tccggacctg cgtaccttca tgatccccag gtctgatctg       540
     gaggtcattg acacctggtt tacttccggc ctgcgaggca caggaagcat ggacatcgcg       600
     gtcaacgatg tcttcgttcc agagcaccgg gtgcaggaat tcggcccact ggcacgaggg       660
     cagtcgccgt ccgcggagct gcacggttcc gctatttacc ggattccgtt gttctgcgcc       720
     ttgtccaatg tcgccgccgc gcctgcggtg ggtatggctc tgggcacggt ggagctgttc       780
     accgagaaga tcaagacccg ggtgatgcgg tactcgatgc aggaacagtc caagctcgct       840
     acggcgcata gacggatggg acatgttgcg gcgcaagcag agtcggcgcg caccctactg       900
     ctacagaccg tgcgtgacgt agaggacaaa ttacgttccg gagagggact gaccaccggg       960
     gaccgggtgg cggtacgccg caactgcgcc tacatcgtcg aggtatgcaa gcaggccatc      1020
     ggtgaggcgg ttgaggcgtg tggggcctcc gcgcagtacg aggattcgcc gctgcagcga      1080
     cacctgcgcg acgtgaatac gttgtccact catgttgtct acgacacaga ttcggcttac      1140
     gagctgtacg ggcgggtgga actcgggctg ccgccgggat ccgtcgcgtt ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page