(data stored in ACNUC30630 zone)

EMBL: CU458896.PE313

CU458896.PE313       Location/Qualifiers
FT   CDS_pept        320076..320516
FT                   /transl_table=11
FT                   /locus_tag="MAB_0317"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q744M2_MYCPA 1e-54"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60416"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFL6"
FT                   /protein_id="CAM60416.1"
FT                   /translation="MGQVSASSSVLIDAAPEAVLAAVADYQNVRPQILSSHYRDYQVLE
FT                   GGQGEGTVASWKLQATESRVRDIKSAVSVAGHTVIEKDANSTLVTTWTVAPAGPGSSVT
FT                   TKTAWTGGGGIKGFFEKTFAPLGLKKIQAEVLANLKQVVEKG"
     atgggtcagg tcagtgcgtc cagttcggtg ttgatcgacg cggcgccgga ggcagtgctc        60
     gccgcggtcg ccgactacca gaatgtgcgc ccgcagatcc tgtccagcca ctaccgcgac       120
     taccaggtgc tcgagggcgg tcagggtgag ggcacggtgg cgtcctggaa gctgcaggcc       180
     accgagtcgc gcgtgcggga tatcaagtcg gccgtgagcg tggctgggca taccgtcatc       240
     gagaaggacg ccaactccac cctggtgacc acgtggactg tggcacccgc cgggcccggc       300
     tcatccgtca ccaccaagac cgcgtggacc ggtggcggcg gcatcaaggg attcttcgag       360
     aagacctttg ccccgttggg actcaagaag attcaggccg aggtactggc caatctcaag       420
     caggtggtgg aaaagggtta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page