(data stored in ACNUC30630 zone)

EMBL: CU458896.PE317

CU458896.PE317       Location/Qualifiers
FT   CDS_pept        complement(322384..323085)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0321c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0321c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60420"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFM0"
FT                   /protein_id="CAM60420.1"
FT                   /translation="MANIISNGPDGDAGATGAQGSQGATGAAGAMANCNWIDDDCATRG
FT                   GTGGTGGNGGPGGAGGPGGHGGVIDFEVETFMDGVTLQAKGGRGGNGGHGGAGGTGGTG
FT                   GKGGDGDDCEFGRTGGNGGTGGRGGDGNFAGTGGNGGAILVKCQHDLSLGTHPMDVSAG
FT                   TGGNGGIGGGGGGGGSVGANGATTGVFSSSSDCSGPGPQPNPGSPGDPGTSVAVSGAQG
FT                   NPGQAQFLIVP"
     atggcgaaca tcatcagcaa tggtcccgac ggcgacgccg gagcgacagg tgcgcaaggt        60
     tcccaaggag ccaccggcgc ggcaggggcg atggccaact gcaactggat tgacgacgac       120
     tgcgccaccc gaggtggcac gggtgggacc ggcggtaacg gcgggcccgg gggtgctggc       180
     ggtcccggcg gccacggcgg cgtgatcgac ttcgaggtgg aaaccttcat ggatggcgtg       240
     acgctgcaag ccaagggtgg ccgcggcggc aacggcgggc acggaggagc aggcggaacc       300
     ggaggcaccg gcggcaaagg cggcgacggg gacgactgcg aattcggcag aaccggcggc       360
     aacggcggca ccggggggcg cggcggagac ggaaatttcg ccggtaccgg cggcaacggc       420
     ggcgccatcc tcgtcaaatg ccagcacgac ctgtccctgg gcacccaccc gatggacgtg       480
     tcggccggca cgggcggcaa tggtgggata ggcggcggtg gcggaggagg cggatcggtg       540
     ggcgccaacg gtgcgacgac gggggttttc tcgtcctcct cagactgcag cgggcccggg       600
     cctcagccca atccgggctc accaggcgat cctgggacct cggtggcggt gtcgggagcg       660
     cagggcaatc cgggtcaagc acagttcctg atcgtcccct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page