(data stored in ACNUC30630 zone)

EMBL: CU458896.PE321

CU458896.PE321       Location/Qualifiers
FT   CDS_pept        complement(325992..326576)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0325c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0325c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60424"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFM4"
FT                   /protein_id="CAM60424.1"
FT                   /translation="MSGSFAGFEGPGSGFGAFSGAGFGGPGFGGPGFGGPGLGPGGPAG
FT                   FGLRIKRAVTASLLLDGPASAAQIVQRVSDATEDEILLPEPVVERVLERLAHKGVVTTE
FT                   DGVATLTDFGRKVLAKRGITSQTAQALRAKVFPKLVNVLKLRSGLAEIAGLARVIAITG
FT                   TDEQKEKLAEAGATLLATVNDVKRSLQSAVA"
     atgtctggtt cattcgcagg cttcgaaggt cccggctccg gtttcggcgc atttagcggg        60
     gccggttttg gtgggcccgg ttttggcggg cccggttttg gtgggcccgg actgggccca       120
     ggagggcccg ccgggttcgg cctccgaatc aagcgcgccg tcaccgcatc gctgctgctc       180
     gacggcccgg cgagtgccgc gcagatcgtg caacgcgtct ccgacgcaac cgaggacgag       240
     atcctgcttc cggagcccgt cgtagaacgt gtcctcgagc ggctggcgca taagggcgtc       300
     gtcacgacag aagacggcgt ggccaccctg accgacttcg gccggaaggt gctcgcgaag       360
     cggggcatca ccagccagac ggcacaggca ctccgcgcca aggtcttccc caagctcgtc       420
     aacgttctca agctccgctc gggactggcg gagatcgccg gcctggcgcg ggttatcgcc       480
     atcaccggca ccgacgagca gaaggaaaaa ctggccgagg ccggcgccac cctgttggcc       540
     acggtcaacg acgtcaaaag gtcgctacag agcgccgtcg cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page