(data stored in ACNUC30630 zone)

EMBL: CU458896.PE335

CU458896.PE335       Location/Qualifiers
FT   CDS_pept        336332..337369
FT                   /transl_table=11
FT                   /locus_tag="MAB_0339"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60438"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFN8"
FT                   /protein_id="CAM60438.1"
FT                   /translation="MAALVILLVATGCTRTVAGQARGGEPVPGADFFFQGEQPDYGQKL
FT                   DAQEKATLIYARALRRVDPCGFASALKEYGDPGQVVGDFQMCYASVKVTGDPSLTEVSY
FT                   EYSMQDKRDASAAFRVGPVPVYETGEECEYEVPLGLERLPGAPSSPPLHAMLSVSAYLY
FT                   GSDEYSDPDCRVAKQVVTAIAKQLPSGLQPRSALSTYPIKLAERDPCEILREYPGKARG
FT                   VSIDLLGDPFGCDFSLPDSDIDYTVQLTSSVNDFPDEYTKSTRDGVTYFHNEDPSQLTG
FT                   CHALALVGDPLYPKDIGGGAANTDADAYFPAIVASAFTGRDRKDCGHMREILDKAVRLF
FT                   ANSAR"
     atggcggcgc tggtgatcct gctggtggcc accggctgca cgcgcacggt cgccgggcag        60
     gcccgaggcg gcgaacccgt tcccggggcc gactttttct ttcaaggtga acaaccggac       120
     tacggccaaa agctcgatgc tcaggagaag gcgacactga tctatgcgcg agcgctgcgc       180
     cgggtggacc cctgcggctt cgcgagcgct ctcaaggagt acggcgatcc gggacaagtc       240
     gtcggcgact ttcagatgtg ttatgccagc gtgaaggtca cgggtgaccc cagtctcacc       300
     gaggtgtcct acgaatactc gatgcaggac aagcgcgacg cctcggctgc cttccgggtg       360
     gggcctgtgc cggtctatga gaccggagaa gagtgcgaat acgaggtacc tctgggtctc       420
     gaacggctgc cgggtgcgcc gtccagtccc ccactgcacg ccatgttgtc ggtctccgcg       480
     tacctgtacg ggtcggacga gtattccgat cccgactgtc gggtggccaa gcaggtggtg       540
     acggcgatcg ccaagcagct tccctcgggg ttgcagccgc gttccgcgct cagcacctac       600
     ccgatcaagc tcgccgagcg ggatccgtgc gagattctgc gggagtatcc gggcaaggcg       660
     cgcggggtgt cgattgacct actgggtgat ccctttggct gtgacttctc gctgccggac       720
     tccgatatcg actacaccgt gcagctcacc agcagcgtga acgacttccc ggatgaatac       780
     acgaagtcca cgcgtgacgg ggtgacgtac ttccacaatg aggacccgtc gcagttgacc       840
     gggtgccatg ctttggcttt ggtgggagac ccgctgtatc ccaaggacat tggtggtggc       900
     gcggccaaca ccgacgcgga cgcgtacttt cccgccattg ttgccagcgc cttcaccgga       960
     agggaccgga aggattgcgg gcacatgcgg gagattctgg ataaggcggt gcgactattc      1020
     gcaaactccg ctcggtag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page