(data stored in ACNUC30630 zone)

EMBL: CU458896.PE343

CU458896.PE343       Location/Qualifiers
FT   CDS_pept        344374..345588
FT                   /transl_table=11
FT                   /locus_tag="MAB_0347"
FT                   /product="Cell division control protein 48 CDC48"
FT                   /note="Similar to Q9RWL9_DEIRA 4e-58"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60446"
FT                   /db_xref="GOA:B1MFP6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFP6"
FT                   /protein_id="CAM60446.1"
FT                   /translation="MANDAVITEMLAAVEASPDVLALRLRVIELLISSRRFAEALNHCT
FT                   VALQQAPGDARALELLAACSAGLNSPAPEPVAASAGFDWSAAEDQVADIVRPAFVEEEP
FT                   EPLGPNDVGALEKSDVRLADVGGMADVKRQLDLSLFGPLRNPELVKAFGVSARGGLLLY
FT                   GPPGCGKTFLARAVAGELGANFYPVGIADVMHPIFGQSEQRMHEIFEIARRNAPCVLFF
FT                   DELDALGHRRSQLSGSSGLRPLVNQLLAELDPATESNEGLYVLGATNHPWDVDAALRRP
FT                   GRFDRMILVALPDEEARIAIVKYHLRDRPLEGINLKSIAKRTEGRSGADLAHICNTATQ
FT                   FAMADSISTGQVRPVRMADIDTAIAQVGASAGGWFDTARNVVEFSNSDGTYDELAKYLR
FT                   HRRSR"
     gtggccaacg acgccgtgat caccgagatg ctggccgcgg tggaggccag tcccgacgtt        60
     ctcgcgctgc gattgcgtgt catcgagctg ctgatctcaa gccgccgctt tgccgaggcg       120
     ctgaatcact gcaccgtggc gttgcagcag gcgccgggag acgccagggc gctggaattg       180
     ctcgccgcat gttcggccgg cctgaactct ccggctcctg agccggtagc ggcctcggcg       240
     ggctttgact ggtcggcggc cgaggatcaa gtggccgata tcgtccggcc cgccttcgtc       300
     gaggaagagc ccgaaccatt ggggccgaac gatgtggggg cgttggagaa atccgatgtg       360
     cggctcgcgg acgtcggcgg tatggccgat gtcaaacgac agttggacct ctcattgttc       420
     gggccgctcc gcaatcccga gttggtcaag gcctttggcg tctcggccag aggcggcctg       480
     ctgctgtatg ggccgccggg atgcggcaag accttcctgg cccgtgcggt ggccggtgaa       540
     ctgggcgcca atttctatcc cgtcggtatc gcggatgtca tgcatccgat ctttggccag       600
     agcgaacaac ggatgcatga gatctttgag atcgcacggc gcaatgcgcc gtgtgtgctg       660
     ttcttcgatg aactggacgc tctggggcat cgccgttcgc agctgtcggg aagttcgggg       720
     ctgcggccgc tggtgaatca gcttctggca gagctagacc cggcgactga gagtaacgag       780
     gggctttacg tcctgggtgc taccaaccac ccatgggatg tggacgccgc gctgcgcagg       840
     cccggacggt tcgaccggat gatcttggtg gcgttgcctg acgaggaggc gcggatcgcc       900
     atcgtcaagt accacctgcg agatcggccg cttgaaggca tcaatctgaa atcaatcgcc       960
     aagcgcaccg aggggcgctc gggcgccgac ctggcccata tctgcaacac cgctactcaa      1020
     ttcgcgatgg ccgactcgat cagtaccggg caggtgcggc cggtacggat ggcagatatc      1080
     gacacggcca tcgcacaggt gggtgccagt gcgggcggct ggttcgacac cgcgcgcaat      1140
     gttgtcgaat tctccaactc ggacggcacc tatgatgagt tggcaaagta tctgcgccat      1200
     aggcgatctc ggtga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page