(data stored in ACNUC30630 zone)

EMBL: CU458896.PE35

CU458896.PE35        Location/Qualifiers
FT   CDS_pept        complement(34710..36167)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0036c"
FT                   /product="Probable cell division protein RodA"
FT                   /note="Similar to Q744R2_MYCPA e-148"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0036c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60138"
FT                   /db_xref="GOA:B1ME74"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME74"
FT                   /protein_id="CAM60138.1"
FT                   /translation="MTTAPQTAVGPSGRGSGAVSAPPTQSTRRSAELGLLGFAAAITTV
FT                   ALVLVEANLERGLSWDLLGYGFAYLVLFVLAHMAVRRWAPYADPLLLPCVALLNGLGLV
FT                   MIHRLDLVHSYNDGDADQVGDNNATQQMLWTTVGLIALAAVLATLKDHRVLARYGYTFG
FT                   IVGCVLLAIPALLPTSMSEQYGAKIWIELPFLSIQPAEAAKILLLIFFAAFLMTKRTLF
FT                   RTAGRNYLGIELPRPRDLGPLLAIWGISVGVMVFEKDLGASLLFYSSFLIVLYVATARI
FT                   SWVLIGLALFAAGSVIAYFLFGHVQVRVQNWWDPFTDPDGAGYQMVQSLFSFATGGIFG
FT                   TGLGNGQPGTVPAASTDFIIAAVGEELGLVGLAGVLMLYTIVIIRGFRTALAVRDSFGK
FT                   LLAVGLSAALAMQLFIVVGGVTKLIPQTGLTTPWMSYGGSSLIANYVLLAILLRISHIA
FT                   RRPLSPHASSSPAAPLAEARTELIDRV"
     atgacgacgg cgccccaaac cgcggtagga cccagtggaa ggggcagcgg agccgtttcg        60
     gcgccgccca ctcaatcaac acgacgtagc gcggagctgg ggctcctcgg cttcgccgcc       120
     gccatcacca cggtggccct agttctcgtc gaggccaacc ttgagcgtgg gttgtcctgg       180
     gatctgctgg gatacggctt cgcctacctc gtgcttttcg tcttggcgca catggcggtc       240
     cgtcgctggg ctccgtatgc cgatccgctg ctgctgccgt gcgtcgcgct gctcaacgga       300
     ctcggcctgg tgatgatcca tcggctggat ctcgtgcact cgtacaacga cggcgatgcc       360
     gatcaggtcg gtgacaacaa cgctacgcag cagatgctgt ggaccacggt cggcctgatc       420
     gcactcgctg ccgtgctggc caccttgaag gaccaccggg tgctggcccg ttacggctat       480
     acattcggga tcgtcggctg cgtgctgctg gccatccccg ccctgctgcc cacatccatg       540
     tccgagcaat acggtgccaa gatctggatt gagttgccat tcttgtcgat tcagcccgcg       600
     gaggccgcca agatcctcct gctgatcttc ttcgccgcat tcctgatgac caaacgcacg       660
     ttgttccgca ccgccggccg caactatctg ggcatcgagc tgccgcggcc acgcgacctg       720
     ggcccgttgc tcgccatctg gggaatctcg gtgggcgtca tggtcttcga gaaagacctc       780
     ggagcctcac tgctcttcta ctcgtcgttt ctcatcgtcc tctacgtcgc caccgcccga       840
     atcagttggg tgctcatcgg tttggcgctc ttcgccgccg gcagtgtgat cgcctacttc       900
     ttgttcggtc acgttcaggt gcgcgtgcag aactggtggg atccgttcac cgatcccgac       960
     ggcgccggct atcagatggt ccaatcgctg ttcagcttcg ccaccggcgg cattttcggc      1020
     accgggctgg gcaacggcca accgggcacg gtgcctgcgg cctcaaccga tttcatcatc      1080
     gccgcggtgg gtgaggaact cggtttggtg ggcctggccg gggtgctcat gctgtacacg      1140
     atcgtgatca tccgcgggtt ccgtaccgcg ctcgcggtgc gcgacagctt cggcaagcta      1200
     ctggcggtgg gactgtccgc cgcgctggcc atgcagctgt tcatcgtggt cggcggcgtc      1260
     accaagctga tcccacagac cggtctgacc accccgtgga tgtcgtacgg cggttcctcg      1320
     ctcatcgcca actacgtgct gctcgccatc ctgctgcgca tttcacatat cgcacgccgg      1380
     ccactgagtc cacacgcttc ctcatcgccc gccgccccgc tcgcggaggc ccgcacggaa      1440
     ctgatcgacc gcgtatga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page