(data stored in ACNUC30630 zone)

EMBL: CU458896.PE357

CU458896.PE357       Location/Qualifiers
FT   CDS_pept        357727..358353
FT                   /transl_table=11
FT                   /locus_tag="MAB_0361"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25T61_MYCVN 4e-09"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60460"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="InterPro:IPR038232"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFR0"
FT                   /protein_id="CAM60460.1"
FT                   /translation="MTIVLSAALACAAPALAEQGSPIPPAAIDDLMVTPDEASSVMKTG
FT                   FPVVDRFNALSALTTDRPDCGSVVLPSVATYDRGPYMAAHQQYLQDSAPWNVQLAQSIA
FT                   VFPTDDEARDFASTEMDMWLKCSKHTVHDSAQWRYAIGSLHRDDDAVVGSYVMITNDGA
FT                   RMSCSRLLARVRNTATDLRACSAGPESYQRLLGIAKIIGPRYDAA"
     atgacgatcg tgctgtcggc ggcattggct tgtgccgcac ctgctttggc tgagcaaggc        60
     tcgccgatac cgcccgccgc gatcgacgat ctgatggtca caccggatga ggcgtcctcg       120
     gtgatgaaga cgggctttcc ggtggttgat cggttcaacg cgctctcggc cctcacgacg       180
     gacaggccgg actgtggcag cgtggtgctg ccgtcggtgg ccacctacga ccgcgggcca       240
     tacatggccg cgcaccagca gtacctacag gacagcgctc cctggaacgt ccagcttgcc       300
     cagagcatcg ctgttttccc cacggacgat gaggcccgcg acttcgcgtc cacggagatg       360
     gacatgtggt tgaagtgttc gaagcacacc gtgcacgatt ccgcccagtg gaggtacgcg       420
     atcgggtcat tgcatcggga tgacgacgcg gtagttggtt cctacgtgat gatcacgaac       480
     gatggtgcgc gtatgtcctg ctcccggctg ctggccagag tccggaacac cgccaccgac       540
     ctgcgcgcat gctcggccgg acccgaaagc taccaacgtc tgctggggat cgcgaagatc       600
     atcggccccc gctacgacgc cgcctag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page