(data stored in ACNUC30630 zone)

EMBL: CU458896.PE370

CU458896.PE370       Location/Qualifiers
FT   CDS_pept        complement(370074..371549)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0374c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to O69666_MYCTU 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0374c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60473"
FT                   /db_xref="GOA:B1MFS3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFS3"
FT                   /protein_id="CAM60473.1"
FT                   /translation="MGDEVARTQFTGEHRRAYRTKVQNCLDVFETMLAESRFDFERPLT
FT                   GLEIEFNLVDGNYQPAMTNTEVLASIADPAFQTELGAYNIEMNVPPRALPGSAALELEE
FT                   DVRASLNAAEQRAGERGAHIVMIGILPTVMPENLDGAWMSPSSRYRALNDAVFSARGED
FT                   MQIDIAGTERLSVRSPSIAPESACTSIQLHLQVAPDDFAANWNAAQALAGPQLALAANS
FT                   PFFFGKSLWAETRIELFTQSTDTRPQELKVQGVRPRVWFGERWITSIFDLFEENVLYFP
FT                   SLLPEISDEDPVAELAAGRAPRLQELRLHNGTVYRWNRPIYDVVNGTPHLRVENRVLPA
FT                   GPSVIDVMANAAFYYGALRSLSEDDRPVWTKMTFSAAHDNFLSGARHGTSAKLYWPGVG
FT                   EITADELTLRYLLPMAHEGLRRWGVAPQVRDRYLGVIEARAKSGINGAAWQTRTVSALE
FT                   RRGLNRKQALTEMLRKYCAHMHSNEPVHTWELI"
     atgggcgacg aagtggcgcg cacccagttc accggtgagc accgccgggc ctatcgcacc        60
     aaggtgcaga actgtctgga cgtgttcgag acgatgctcg ccgagtcccg gtttgacttc       120
     gagcggccgt tgaccggctt ggaaatcgag ttcaacctcg tagacggcaa ttatcagccc       180
     gcgatgacga acaccgaggt actcgcctcg atcgccgacc ccgcctttca aacggagctg       240
     ggcgcctaca acatcgagat gaatgtgccg ccccgcgccc tgccgggttc ggcggccctc       300
     gaacttgagg aggacgtgcg ggccagcctc aacgccgccg agcagcgggc cggtgagcgc       360
     ggcgcgcata tcgtgatgat cgggatcctg ccgacggtga tgcccgaaaa tctcgatggc       420
     gcatggatga gcccctcctc ccggtatcgg gcactgaacg atgccgtgtt ctccgcccgc       480
     ggtgaggaca tgcaaatcga catcgccggc acggagcggc tcagcgtcag gtcaccgtcc       540
     atagccccgg aatcggcgtg caccagcatt cagctgcacc tgcaggtggc gcccgacgac       600
     tttgccgcca attggaatgc cgcccaggca ctggcggggc cgcagctggc gctggctgcc       660
     aactctccgt tcttcttcgg caagtccttg tgggccgaga cgcgtatcga gcttttcacc       720
     caatccaccg acacccggcc acaggagctc aaggtgcagg gagtacggcc gcgggtgtgg       780
     ttcggcgagc gctggatcac ctcgatcttc gacctcttcg aagagaacgt cctctatttc       840
     ccgtcgctgc tacccgagat ctccgacgag gaccctgtcg ccgaactcgc ggccgggcgg       900
     gcgccccggc ttcaggagct gcggctgcac aacggaaccg tctatcggtg gaaccggccg       960
     atctacgacg tggtcaacgg caccccgcat ctgcgtgtgg aaaatcgggt gctacccgcc      1020
     gggccatcgg tgatcgatgt gatggccaat gccgcgttct attacggcgc gctgcggtcg      1080
     ctgtccgagg atgaccgccc ggtgtggaca aagatgactt tcagtgccgc acatgacaat      1140
     ttcctgtcag gagcgcggca cggcacgtcg gccaagctct actggcccgg agttggtgag      1200
     atcaccgccg acgaattgac gctgcgatac ctgctgccga tggctcatga ggggttgcgg      1260
     cgctggggag tggcgccgca agtgcgtgac cgctatctcg gcgtcatcga ggcacgtgcg      1320
     aagtcgggca tcaacggcgc cgcgtggcag acgcggacgg tcagcgcatt ggagaggcgc      1380
     ggactgaacc gcaaacaagc tctcaccgag atgctccgga agtattgcgc gcacatgcat      1440
     tccaacgaac cggtacacac ctgggagctg atctaa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page