(data stored in ACNUC30630 zone)

EMBL: CU458896.PE377

CU458896.PE377       Location/Qualifiers
FT   CDS_pept        377163..377966
FT                   /transl_table=11
FT                   /locus_tag="MAB_0381"
FT                   /product="Glycerol uptake facilitator protein (GlpF)"
FT                   /note="Similar to Q826J3_STRAW 2e-82"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60480"
FT                   /db_xref="GOA:B1MFT0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFT0"
FT                   /protein_id="CAM60480.1"
FT                   /translation="MGQLAAEFVGTLILILFGVGVVAQVVTAGDEDYGNHNSIAWAWGM
FT                   GVTFGIFAAGRISGAHLNPAVTVALAVFRGFPWKQVIPFILAQVGGAFVAALLVRWNYG
FT                   SVLAAIDPGHTIATQGVFSTLPGNGALDVSLWGGLRDQIMGTAILLFLIFAITDRRNIR
FT                   MPEIFAALSIGAVVVGLGMAWGSIAGYAINPARDFGPRLASYLTGFDTAFLDQHGAQYW
FT                   WVPIVGPFIGGLVGAALYRYLVEPFLPADDPVTQSPSHTEEFANG"
     atgggtcaac tcgccgcgga gttcgtcggc accctgatct tgatcctgtt cggggtgggc        60
     gtcgtcgcgc aggtggtcac ggcgggcgac gaggattacg gcaaccacaa ctccatcgcc       120
     tgggcctggg gcatgggagt caccttcggc atcttcgcgg ccgggcggat atccggcgcg       180
     catctcaacc cggcggtcac ggtggccctg gccgtctttc gcggattccc atggaaacag       240
     gtaattccat tcatcctcgc tcaggtcggc ggcgcatttg tcgcggcgct gctggtccgg       300
     tggaactatg gaagtgtgct ggcggcgatc gatcccgggc acaccatcgc gacgcagggc       360
     gtgttctcga cattgccggg taacggcgcg ctcgacgtca gcctgtgggg cggcctgcgt       420
     gaccagatca tgggcaccgc cattctgctg tttctgatct tcgccatcac ggaccggcgg       480
     aatattcgca tgcccgagat attcgccgcg ctttcgatcg gtgctgtggt cgtcggattg       540
     ggtatggcat gggggtccat cgccgggtac gcgatcaacc cggcccgtga cttcggtcca       600
     cggctcgcgt cctatctcac cggtttcgat acggcctttc tggaccagca cggtgcccag       660
     tactggtggg tgccgatcgt cgggccgttc atcggtggtc tggtgggcgc cgcgctatac       720
     cggtacctgg tcgaaccatt cctacccgca gatgatcctg taacccaatc accttcgcat       780
     accgaggagt tcgccaatgg ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page