(data stored in ACNUC30630 zone)

EMBL: CU458896.PE380

CU458896.PE380       Location/Qualifiers
FT   CDS_pept        380424..380798
FT                   /transl_table=11
FT                   /locus_tag="MAB_0384"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q744L6_MYCPA 1e-36"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60483"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFT3"
FT                   /protein_id="CAM60483.1"
FT                   /translation="MTVKWLDKPEDHDYQAATDYLTLVGEADLVKRTVKALRNATLEYR
FT                   KAKDILRAARLEMLPKTNAHVARDLAKIAKDKALSPILLVRGDARSGARLEIADGYHRV
FT                   CASYISDENTDIPCHLVSWQ"
     atgacggtga agtggctgga taagcccgag gatcacgact accaagcggc cacggattac        60
     ctgacgctcg tcggtgaggc ggatctggtg aagcggacgg tgaaggcgct gcgcaatgcg       120
     acgctggagt atcgcaaggc caaggacatc ttgcgggcgg cacgcctgga gatgctgccc       180
     aagacaaatg cccatgtggc ccgtgacctg gcgaagatag ccaaggacaa ggcgctgtcg       240
     ccgatcctgc tggtgcgcgg cgacgcgcgc agcggagccc gcctggaaat cgccgatggt       300
     tatcaccggg tgtgcgccag ctatatatcc gacgaaaaca ctgacattcc ttgccatctc       360
     gtctcgtggc agtag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page