(data stored in ACNUC30630 zone)

EMBL: CU458896.PE381

CU458896.PE381       Location/Qualifiers
FT   CDS_pept        380803..382041
FT                   /transl_table=11
FT                   /locus_tag="MAB_0385"
FT                   /product="Conserved hypothetical protein (cation
FT                   transporter?)"
FT                   /note="Similar to Q73UT6_MYCPA 5e-95"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60484"
FT                   /db_xref="GOA:B1MFT4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFT4"
FT                   /protein_id="CAM60484.1"
FT                   /translation="MSGFGFPTLAIVVIVGMIGPLLALNTRLRIPVVIGELLAGIVIGR
FT                   TGFGWIDAFDPTFKMFADVGFALVMFVAGTHVPVRDKTMRASLPQAALRAIVVGAVAAV
FT                   LGVLLANVFHTGHAPLYAVLIASSSAALVLPVIDSLGLGGPKVLITTAQVAIADTASII
FT                   LLPLVIDLKHAPRAAVGAVAVAACAGIVFVILHALDQAGKLDRFHDYSKQRRVAMELRI
FT                   SLAIVFGLAALAVETHVSIMLAGFALGLVVAGIGEPRRLAKQLFGFTEGFFSPLFFVWL
FT                   GASLHVRELGENPKLILLGVGLGVAAVLAHLVVRIFGQPLPLGALAAAQLGVPIAAAAI
FT                   GEQQQSLIHGEASALILGALVTIAAATVGGSLYAKTSQGNQPGVAKPERPVDDSEGSGA
FT                   GGGAEGAGGGVAG"
     atgagtggat ttggattccc gaccctggcg attgtcgtta ttgtcgggat gatcgggccg        60
     ctgctcgcgc tcaacacgcg actgcggatt ccagtcgtca tcggggaact gctcgctgga       120
     attgtcatcg gacgcaccgg gttcggttgg atcgacgcct ttgacccgac cttcaaaatg       180
     ttcgccgacg tggggttcgc gctggtcatg ttcgtggcgg gcacccatgt tccggtgcgt       240
     gacaagacca tgcgggcatc gctacctcag gcggcgctgc gcgcgatcgt ggtcggtgcg       300
     gtggccgcgg tgctgggtgt gctgttggcc aacgtgttcc ataccgggca tgcaccgctg       360
     tacgcggtcc tcatcgcctc ctcgtcggcg gcgctggtgc tgccggtcat tgactcgctg       420
     ggactcggcg gccccaaggt gctgatcacc accgcgcagg tggccattgc cgatactgcc       480
     tcgattatct tgttgccgtt ggttatcgac ctcaaacatg cgccgcgcgc ggcggtcggc       540
     gcggtcgccg tggccgcctg cgcgggcatc gtcttcgtga tcctgcatgc gttggatcag       600
     gccgggaagc tggatcggtt ccacgactac tcgaaacaac gccgcgtcgc gatggaactg       660
     cgcatcagcc tggccatcgt cttcggcctc gccgccctgg ccgtggaaac ccacgtctcg       720
     atcatgctgg cgggtttcgc gctcggtctg gtcgtagccg gtatcgggga accacgccgc       780
     cttgccaagc agctcttcgg tttcaccgaa ggtttcttct cgcccctgtt cttcgtgtgg       840
     ctgggggcgt cgctacacgt gcgcgagctc ggtgaaaatc ccaagctcat cctgctgggt       900
     gtcggtttgg gtgtcgcggc ggtgctggcc catctggttg tacggatctt tggtcagccg       960
     ctaccgctgg gcgcgttggc ggctgcccag ctgggggtgc ccatcgccgc ggcggcgatc      1020
     ggtgaacagc agcagtcact gattcacggc gaggcttccg cgctcattct cggtgcgttg      1080
     gtcacgattg ccgcggcgac ggtcggtggc tcgctgtatg cgaagacgtc ccagggcaat      1140
     cagccgggcg tggcgaaacc cgaacgtccc gtggacgatt cggaaggctc cggtgccggt      1200
     ggtggtgcgg agggcgccgg tggtggtgtc gccggatag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page