(data stored in ACNUC30630 zone)

EMBL: CU458896.PE388

CU458896.PE388       Location/Qualifiers
FT   CDS_pept        complement(387904..389112)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0392c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q26YN4_MYCFV 4e-50"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0392c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60491"
FT                   /db_xref="GOA:B1MFU1"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFU1"
FT                   /protein_id="CAM60491.1"
FT                   /translation="MSNDEGGVTPSPLPPGPSPAYPPPAPGYPPAGTAGYPPPGFAYQP
FT                   PPPGYQNPSAVPYWVTPEPPALKPGVIPLRPLDLSSLYNGAIAAIRANPKTTLGLTAIV
FT                   VIVSQLLIFGIQAAPATAVLTGAASFDKNTEDSFGAAFGLGYIGGQLIGAVVTSLVTII
FT                   LSGMLTVTIGRSVFGERTTIKEAWQRAKPRIWALLGVAVVELVLFAVVLGFGVAVVVGL
FT                   ALTVGPAGAIPAGLLLALAYFLFYLYLIPVFSLVPSVLILEQQSVFGAIGRSVSLVRKG
FT                   FWRLLGILVLTGFIVGFVSMIIGMPFILVGEVAAFAGSDPNNLGPKMLLIFALAAVGAV
FT                   IAQIISLPFKAAVNVLLYTDQRMRTEALDLVLQTEARTRERLGQPGIDPDSLWLPMRPP
FT                   VQV"
     atgagcaacg acgagggggg cgtcactccg tctccgctac ccccgggacc ctcacccgcc        60
     taccctccgc ctgcccctgg ctacccccct gccggcacag ccgggtatcc gccaccgggt       120
     ttcgcatatc aacccccgcc gcccgggtac cagaatccgt cggcagtgcc ctactgggtg       180
     acgccggagc cgccggccct gaaaccgggt gtcatcccgc tacggccgct ggatttatcc       240
     tcgctctaca acggcgccat cgcggccatc cgagccaacc ccaagaccac actcggcctt       300
     accgccatcg tcgtcatcgt cagtcagctc ctgatcttcg gaatccaggc ggcaccggcg       360
     acggcagtcc tgacgggtgc ggcgtccttc gacaagaaca ccgaagactc gttcggcgca       420
     gcgttcggcc tcggctacat cgggggccag ctgatcggtg ccgtggtcac ctccctggtc       480
     accatcatct tgagcggaat gctgaccgtc accatcggcc gatccgtctt cggtgagcgc       540
     accaccatca aggaagcctg gcagcgtgcc aagccgcgca tctgggctct ccttggcgtc       600
     gccgttgtcg agctggtgct gttcgccgtg gttctcggat tcggcgttgc ggtggtggtc       660
     ggcttggcgc tcaccgtcgg tcccgcgggc gcgattcccg ccgggctgct gttggccctg       720
     gcctacttct tgttctacct ctatctcatc cccgtgttca gtctcgttcc ctccgtgctg       780
     atcctggaac aacagagcgt cttcggcgcg atcggccgct cggtctcgct ggtacgcaag       840
     ggtttctggc ggctgctggg catcctggta ctcaccggat tcatcgtggg attcgtctcg       900
     atgatcatcg gcatgccctt catcctcgtc ggggaagtcg cggcattcgc cggcagtgat       960
     cccaacaatc tcggccccaa gatgctgctc atcttcgcgc tcgccgcagt cggggccgtg      1020
     atcgcgcaga tcatctccct gccgttcaag gcggcggtga acgtgctgct ctacaccgac      1080
     cagcggatgc gtaccgaggc gctggacctg gtattgcaga ccgaggccag aacgcgcgag      1140
     cgactcggcc agccgggtat cgatcccgat tccctgtggc tgcccatgcg tcccccggtt      1200
     caggtgtaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page