(data stored in ACNUC30630 zone)

EMBL: CU458896.PE392

CU458896.PE392       Location/Qualifiers
FT   CDS_pept        complement(392190..392798)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0396c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0396c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60495"
FT                   /db_xref="GOA:B1MFU5"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFU5"
FT                   /protein_id="CAM60495.1"
FT                   /translation="MTQPQYPQGQFQQTQPQQFPTYQQPSPYGMPPGGYAPAPKPPRPP
FT                   LTPQQKALAIVGGSLGVFLIALLVLGLTTNNSSTESVRTHASDQIIDSPRSSGSNDEQD
FT                   IKAIKQTISGMAEAAKANDFKKMLTFFCAKYREAFKDIAGSGQAPDLNALTKSDNGPSK
FT                   ITGLDINGDTAVIHITDAKGKHDIEFKKETGGWKFCPRA"
     atgacgcaac cgcagtaccc acaaggccag ttccagcaga ctcagcccca gcagttcccc        60
     acatatcagc agcccagccc gtacgggatg cctccgggcg gctacgcgcc tgcccccaag       120
     ccgccccggc cgccgctgac cccgcagcag aaggcgctgg ccatcgtcgg cggctcgctc       180
     ggcgtcttcc tgatcgccct gctcgtcctg ggcctcacca ccaacaattc cagcaccgag       240
     agtgtccgga cgcatgccag cgaccagatc atcgattcgc cccgctcctc cggctccaac       300
     gacgagcagg acatcaaggc gatcaagcag accatctccg ggatggccga ggccgccaag       360
     gcgaacgact tcaagaagat gctcaccttc ttttgcgcca agtatcgcga ggcgttcaag       420
     gacatcgccg gcagcggtca ggcacccgat ctcaacgccc tgaccaagtc cgacaacggc       480
     ccgtcgaaaa ttaccggcct ggacatcaac ggcgacacgg cggtcattca catcaccgac       540
     gccaaaggca agcacgatat cgagttcaag aaggagaccg gcggctggaa gttctgcccc       600
     agggcctag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page