(data stored in ACNUC30630 zone)

EMBL: CU458896.PE399

CU458896.PE399       Location/Qualifiers
FT   CDS_pept        404240..404734
FT                   /transl_table=11
FT                   /locus_tag="MAB_0403"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q9RJM9_STRCO 1e-06"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60502"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFV2"
FT                   /protein_id="CAM60502.1"
FT                   /translation="MTRFVLFAGITLAACVFAGCGAAPNSTSNSIRQTSTPAAAASPGR
FT                   AEPSRRVVPPGGVYWNPVTQQPEVKPVEIVLTPADAGDMLVDITWDSWTEQQAGGHAIR
FT                   ATKDCVPDCATGGTTRRDVTLTFHDARSLPDDSGWWQYTKLVITGRDGTSETIDMPVTA
FT                   R"
     atgacgcggt tcgtgttgtt cgccggaatt accttggcgg cgtgtgtttt tgcgggctgc        60
     ggtgccgccc cgaactcgac ctcgaattcg atacggcaga cgtccacgcc ggcagcagcg       120
     gcctcgccgg gccgggccga gccgtcgcgt cgggtggtgc cgccgggtgg cgtctactgg       180
     aacccggtga cgcagcagcc cgaggtcaag cccgtcgaga ttgtgctgac ccccgccgac       240
     gccggagaca tgctcgtcga catcacctgg gacagctgga ctgagcagca ggccggcggg       300
     cacgccatcc gcgccacgaa ggactgcgtg cccgattgcg cgacgggcgg gacaacccgg       360
     cgggacgtga cactgacctt ccacgacgcg cggtcgcttc ccgacgacag cggatggtgg       420
     cagtacacca agctggtcat caccggccgt gacggcacat cagagaccat cgacatgccg       480
     gtgacggcgc ggtag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page