(data stored in ACNUC30630 zone)

EMBL: CU458896.PE403

CU458896.PE403       Location/Qualifiers
FT   CDS_pept        complement(407836..408798)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0407c"
FT                   /product="Conserved hypothetical protein (metallophospho
FT                   esterase?)"
FT                   /note="Similar to Q265Y0_MYCVN e-132"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0407c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60506"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFV6"
FT                   /protein_id="CAM60506.1"
FT                   /translation="MSTSLNTVIKRAAAYSAGSAALGIGYASIIERNAFTVREATMDVL
FT                   DPGASPLRVLHISDIHMRPGQRLKQAWLRELAQWQPDLVINTGDNLAHPKAVSSVVQSL
FT                   GDLLSIPGLFVFGSNDYFGPRLKNPAKYLYKSHERKHGEPLPWQDLRAAFTERGWHDMT
FT                   HTRREIEVGGVRIAAAGVDDPHLHRDRYDTIAGMPNPLATLRLGLTHSPEPRVLDRFAE
FT                   DGYQLVMAGHTHGGQLCLPLYGAIVTNCELDRSRVKGPSQWGSHMQLHVSAGIGTSPFA
FT                   PMRFFCRPEATLLTLVPARTSGHGADAESGDRSPSATVQ"
     atgagcacgt cgttgaacac ggttatcaag cgggcggctg cctactcggc gggctcggcc        60
     gcgcttggca tcgggtacgc gtcgatcatc gaacgcaacg cgttcacggt ccgcgaggcg       120
     acgatggatg tgctcgatcc cggcgcgtct ccactgcggg tgctgcacat cagtgatatc       180
     cacatgcggc ccggtcagcg tctcaagcag gcttggctgc gtgagttggc gcagtggcaa       240
     ccggacctgg tgatcaacac cggcgacaat ctcgcacacc ccaaggcggt ctcgtcggtg       300
     gtgcaatccc tgggtgattt gctttccatc cccgggcttt tcgtcttcgg aagcaacgac       360
     tacttcggcc cccgcctcaa gaacccggcc aaatatctgt acaagagcca tgagcgcaag       420
     catggcgagc cgctgccgtg gcaggacctg cgcgctgcgt tcaccgagcg tggttggcac       480
     gacatgaccc acacccgccg cgagatcgag gtcggcggtg tccgcatcgc ggctgccggg       540
     gtggatgatc cgcatctgca ccgggaccga tacgacacca tcgccggcat gccgaacccc       600
     ctggcgacat tgcgactggg cctgactcac tcccccgaac cgcgggtgct ggatcgcttc       660
     gccgaggacg gctatcagct ggtgatggcc ggacacaccc acggcggtca gctgtgcctg       720
     ccgctctacg gcgcgatcgt caccaactgc gagctggacc gctctcgggt gaaaggcccc       780
     tcgcagtggg gttcacacat gcagctgcac gtgtcggcgg gcatcggaac gtcgccgttc       840
     gcgcccatgc gattcttctg ccgcccggag gcgacactgc tgaccctggt tccggctcgc       900
     accagcggcc acggggccga cgccgaatcc ggcgatcgct cgcccagcgc caccgtgcag       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page