(data stored in ACNUC30630 zone)

EMBL: CU458896.PE411

CU458896.PE411       Location/Qualifiers
FT   CDS_pept        415647..416492
FT                   /transl_table=11
FT                   /locus_tag="MAB_0415"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to Q2DZT8_ACICE e-18"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60514"
FT                   /db_xref="GOA:B1MFW4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFW4"
FT                   /protein_id="CAM60514.1"
FT                   /translation="MNSIPLALAGSLSWGISDFIGGHASKRRSTLAVLALSRPVGLAVV
FT                   GLVSVLTASTHFDGRTLLGMLSGPAAFAALYALYRALAIGPMGVVSPIAAVGAVVPVLW
FT                   GTVIGQSLAGLTYLGLGGTLVGVMLASASEGLDGQRPGRQVLVWSFFCMVMFGICMILL
FT                   AEAGRYHPVEAVVVSRATEVVLILILGALSWNNLRENLRPPFGVVPFAGVLDTSAMLLF
FT                   AYAAGHGSLAVAAVLSSLYPVVTVLIARLVLHERLSRVQQTGAVLTLVCVAVVVFSAAR
FT                   "
     gtgaactcga ttccccttgc cctcgcgggc tcactgagct ggggcatcag tgacttcatc        60
     ggcgggcatg cgagcaagcg gcggtcgacc ctggcagtac tcgcgttgag tcggcccgtc       120
     gggctggcgg tggtcgggct ggtgtccgtg ctcaccgcct ccacgcattt cgatggccgc       180
     accctactcg gaatgctttc cggtccagcc gctttcgcgg ctctgtacgc gctgtatcgc       240
     gcccttgcga ttgggccgat gggtgtggtg tcaccgattg cggcggtcgg tgcggtggta       300
     ccggtgctgt ggggcaccgt gatcgggcag tcgctcgcgg gcctgacgta tctggggttg       360
     ggcggcaccc tcgtcggggt catgctggcc tcggcctccg aaggactcga cgggcagcgg       420
     ccgggacgac aggtgctggt gtggtcgttc ttctgcatgg tgatgttcgg gatctgcatg       480
     atcctgctgg ccgaggccgg taggtatcac cccgtggagg cggtggtggt ctcccgcgct       540
     accgaggtcg tgctgatcct gatactcggg gcgctgagct ggaacaacct gcgcgaaaac       600
     ctgcgtccac cgttcggggt ggtgcccttc gccggtgtgc tcgacacctc ggccatgctg       660
     ctgttcgcct acgccgccgg gcacggcagc ctggctgtcg ccgccgtgct gtcctcgcta       720
     tacccggtgg tgacggtcct catcgcccgg ttggtacttc atgagcgcct cagcagggtt       780
     caacagaccg gtgcggtgct gacgcttgtg tgcgtagctg tcgtggtgtt cagcgcggcg       840
     cgctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page