(data stored in ACNUC30630 zone)

EMBL: CU458896.PE419

CU458896.PE419       Location/Qualifiers
FT   CDS_pept        complement(422256..422777)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0423c"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to Q744D6_MYCPA 1e-37"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0423c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60522"
FT                   /db_xref="GOA:B1MFX2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFX2"
FT                   /protein_id="CAM60522.1"
FT                   /translation="MSSPGSRNYRTDSNGVPITVAAIPLSDPNATGTGEPTIGNLVRDA
FT                   TTQVSALVRAEVELARAEVIRDVKKGVAGSIFFIAALVVLFYSTFFFFFFAAEVLKIWL
FT                   PAWAAYLIIFAAMVFVAVLAVLIGYLQVRRIRGPQATIESVKETANVFSREDEAPSDTK
FT                   AIKPVDPSGW"
     gtgagcagcc ctggaagccg caactaccgc acggacagca atggcgttcc gatcaccgtc        60
     gccgccatcc cgctgtctga tccgaacgcg accggcaccg gcgaacccac catcggcaat       120
     ctcgtccggg acgccaccac ccaggtttcc gccctggtgc gtgccgaggt cgagcttgcc       180
     cgcgccgagg tcatccggga cgtcaagaag ggcgtggcgg gcagcatctt cttcatcgcc       240
     gctctggtgg ttctcttcta ctcgacgttc ttcttcttct ttttcgccgc cgaagtgctc       300
     aagatctggc tgcccgcctg ggctgcctac ctgatcatct tcgccgccat ggtgttcgtc       360
     gcggtgctgg cggttctcat cggctatctg caagtcagac gcatccgcgg accacaggca       420
     accatcgaga gcgtcaagga gacggccaac gtcttcagcc gcgaggatga ggcaccctcg       480
     gacaccaaag ccatcaagcc cgtagacccg tcgggctggt ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page