(data stored in ACNUC30630 zone)

EMBL: CU458896.PE425

CU458896.PE425       Location/Qualifiers
FT   CDS_pept        429479..431128
FT                   /transl_table=11
FT                   /locus_tag="MAB_0429"
FT                   /product="Putative oligopeptide ABC transporter,ATP-binding
FT                   protein"
FT                   /note="Similar to Q6AFU2_LEIXX e-151"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60528"
FT                   /db_xref="GOA:B1MFX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFX8"
FT                   /protein_id="CAM60528.1"
FT                   /translation="MEVPTSDSVVDITGLTVDFEVDKQWVPAVKGVSLSVAKGEVLAIV
FT                   GESGSGKSTTAMAIPALLPPSARVRGSVKLNGAELLGATNDELRAVRGKDVAVIFQEPM
FT                   TALNPVYTIGWQIAEAVCAHKKMSRRQARDRAVELLDLVDMPEPAKRVKHYPHQLSGGQ
FT                   RQRAMIAQALALDPGLLIADEPTTALDVTVQAEILDLMRDLRHRIDAGIILITHDMGVV
FT                   ADMADRIMVMKDGEVVEQGDAEGIFHRAQQPYTRQLLASVPHLGATLHGRDESNPPPTD
FT                   LALSVEHAVIEYPGKSGSFRAVDDVSFTIGRGEVVGLVGESGSGKSTIGRAAVGLLRVA
FT                   SGTICVAGQDISTANRKQLRDIRSKVGVVFQDPGSSLNPRWPIGQSIAEPLTLHTDMDR
FT                   TQREGRVKTLLEQVQLPAAMRNRFPHQLSGGQRQRVGIARALALEPTLLIADEPTSALD
FT                   VSVQATVLDLFAELQREHGFACLFISHDLAVVELVASRIAVLNRGRLAEFGSDTQVLTA
FT                   PKDDYTKRLLAAVPVPDPEQQRIRREERQALR"
     gtggaggtgc ccacaagtga ttccgtggtc gacatcacgg gcctgactgt cgatttcgag        60
     gtggacaagc agtgggttcc ggccgtcaag ggtgtctcgt tgtcggtcgc caagggtgag       120
     gtgctggcga tcgtcggtga atccgggtcg gggaaatcga ctaccgccat ggccatcccg       180
     gccttgttgc cgcccagcgc gcgcgttcgc ggcagcgtga agctcaacgg tgccgagctg       240
     ctcggagcca ccaacgacga gttgcgcgct gtgcgcggca aggacgtcgc cgtcatcttc       300
     caggagccga tgacggcgct gaatccggtg tacaccatcg gttggcagat cgccgaagcc       360
     gtttgtgcac ataagaagat gtcgcgcagg caggcgcgcg accgggccgt tgaattgctt       420
     gatctggtcg acatgcccga gccggctaag cgggtcaagc attacccgca ccagctttcc       480
     ggcgggcagc ggcagcgtgc catgattgcg caggccctcg cgttagatcc cgggctgctc       540
     atcgccgatg agccgaccac cgctctcgat gtgaccgtgc aggccgaaat actggatctc       600
     atgcgtgatc tgcgccatcg tatcgacgcc ggcatcatcc tgatcaccca cgacatgggc       660
     gtggtggccg atatggccga ccggatcatg gtgatgaagg acggtgaggt cgttgagcag       720
     ggcgatgccg agggtatttt ccatcgggct cagcagccgt acacccggca gctgctggcc       780
     tcggtgccgc acctgggcgc caccttgcat ggtcgcgacg aaagcaaccc accaccaaca       840
     gatctggcgc tgagtgtgga acacgcggtc atcgaatatc cgggaaagag tgggagcttc       900
     cgggctgtcg atgatgtgtc gttcaccatc ggtaggggtg aggtggtggg cctcgttggt       960
     gagtcagggt ccggaaagtc cactatcggc cgggcggcgg taggtctact gagggtggca      1020
     tccggaacta tttgtgttgc tggacaggat atttcgactg ccaaccgcaa gcagctgcga      1080
     gatattcgga gcaaggtggg ggtggtcttc caggatcccg gatcctcgct gaacccgcga      1140
     tggccgatcg gccagtcgat tgccgaacca ttgaccctgc acaccgatat ggatcgcacc      1200
     caacgagagg gcagggtcaa gacgctgttg gagcaggtgc agttgccggc cgctatgcga      1260
     aaccgcttcc cccatcagct ctcgggtggg cagcgccagc gtgtcggcat cgcgcgggcg      1320
     ctggcgctgg agccaacgct gttgatcgcg gacgagccga cctccgcgct ggatgtatcg      1380
     gtgcaggcga cggtactcga cttgtttgcc gagctgcagc gcgagcacgg gttcgcctgc      1440
     ctgttcatca gtcacgactt ggcggtagtc gagttggtgg cgagccgtat cgcagtgctc      1500
     aaccgcggcc ggcttgccga attcggctcg gatacacagg tattgaccgc gcccaaggac      1560
     gactacacca agcgcctgtt ggcggccgtg ccagtgccgg atccggagca gcagcggatc      1620
     cggcgcgagg agcgccaggc actgcgctga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page