(data stored in ACNUC30630 zone)

EMBL: CU458896.PE433

CU458896.PE433       Location/Qualifiers
FT   CDS_pept        complement(438800..439024)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0437c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0437c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60536"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGK2"
FT                   /protein_id="CAM60536.1"
FT                   /translation="MRLWWTDPSSGDTGDNSRAEIIAWMETQHGKVYVEDAAGNRVDVG
FT                   IVTPASGPKYLRTYADGVWTNNLLALPKR"
     gtgcgcttgt ggtggaccga tccgtccagc ggtgataccg gcgacaactc tcgcgcggag        60
     atcattgcct ggatggaaac ccagcacggc aaggtctacg tggaggacgc cgcgggtaat       120
     cgggtcgatg tgggcatcgt gacgcccgcg tccggtccga agtatctgcg tacctacgcc       180
     gacggtgtgt ggactaacaa tttgttggcg ctgcccaagc gctaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page