(data stored in ACNUC30630 zone)

EMBL: CU458896.PE44

CU458896.PE44        Location/Qualifiers
FT   CDS_pept        44209..45741
FT                   /transl_table=11
FT                   /locus_tag="MAB_0047"
FT                   /product="Probable PPE family protein"
FT                   /note="Similar to Q73TD6_MYCPA 2e-63"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60147"
FT                   /db_xref="GOA:B1ME83"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME83"
FT                   /protein_id="CAM60147.1"
FT                   /translation="MSAPIWMASPPEVHSALLSAGPGPGALLAAAAQWQALSTQYATAA
FT                   TELTELLGSTVAGSWQGPSAMQYAASHAPYLAWLTQQSAMSATNAVLHETSAAAYTTAL
FT                   AAMPTLAELAANHMIHGVLLATNFFGINTIPIALNEADYIRMWIQAATTMGVYQGVSSA
FT                   ALAATTPTQPSPMIMAPGGEMSRMSADMMSMAAQPQAAESGSALDSSNNIMDQLMRFMT
FT                   NPLGTLQDMIEDFMRNPVAAFFAWFPLLFFIAYEAFFIPFGFTFWGVLLSAPAWLPIVL
FT                   GLALSALVPPAGIEEPGQEDEPGREPTRIERRSPQQDLQLAHVPSGSPTPGGSTTTTVT
FT                   SGGSAPPAPAPATATPAYMVYAVQEDPPAARFGPTLNEGSGAKAPAAGISAAAAAAASA
FT                   RSRARRKRAARIKDPAPQFMDMNSSVAPDFSESAARQTTGVGASARGAGRLGFAGTAPA
FT                   AAGTTAAAGLVERDSGTAEALDGARTVPMLPTSWGTDSEHGPDRPAEGGSST"
     gtgtcggctc cgatttggat ggcttctccc cccgaggtcc attcggcgct gctgagcgcc        60
     ggacccgggc cgggcgcact gctggccgct gccgcgcaat ggcaggcgtt gtccacgcaa       120
     tatgccactg ccgcaacaga acttaccgag ctgctgggca gtaccgtcgc gggttcgtgg       180
     cagggcccca gtgctatgca atacgcggcc agtcacgccc cttacctggc ctggctgacc       240
     cagcagagtg cgatgagcgc caccaacgcc gtgctgcacg aaaccagcgc cgctgcctac       300
     accaccgccc tggcggccat gcccaccctg gccgagctgg ccgccaacca catgatccac       360
     ggagtgctgc tggccaccaa cttctttggt atcaacacca ttcccatcgc gctgaacgag       420
     gccgactaca tccggatgtg gattcaggcc gccaccacca tgggcgtgta tcaaggtgtt       480
     tcgagtgcgg ccctggcggc cacaacacct acgcagccat cgccgatgat catggcaccc       540
     ggcggcgaaa tgtcccgtat gtcggccgac atgatgtcaa tggccgcaca gccgcaagcc       600
     gccgaatccg gcagcgcgct cgatagcagc aacaacatca tggatcagct gatgcggttc       660
     atgaccaatc cgcttggcac gcttcaggac atgatcgaag acttcatgag gaacccggta       720
     gccgcgttct ttgcgtggtt cccgctcttg ttcttcatcg cgtacgaggc cttcttcatt       780
     cccttcgggt tcaccttctg gggcgtgctg ctttcggcgc cggcctggct gccgatcgtg       840
     ctggggctcg cgctatcggc gctggtgcct cccgcaggga tcgaggagcc gggccaggag       900
     gacgagccgg gcagagagcc gacccgcatt gagcgaagga gtccgcaaca ggatttgcaa       960
     ctggctcatg tcccttcggg ctcaccgaca ccgggtggct cgacaaccac cacggtgacg      1020
     tccggcggct cggcaccacc ggcaccggct ccggccacgg ctactccggc ttacatggtg      1080
     tacgcggtgc aggaggatcc accggcggca aggtttgggc cgacgctcaa tgagggcagc      1140
     ggcgccaagg cgccggcggc cggaatctct gccgccgccg cggctgccgc ctcggcacgc      1200
     tcacgcgcgc gccgcaagcg cgcggcgcgg atcaaggatc cggctccgca gttcatggac      1260
     atgaactcgt cggtggctcc ggacttttcg gagtccgcgg cgcggcagac cacgggcgtc      1320
     ggggcgtcgg cgcgaggtgc gggccgactc ggttttgccg gcaccgctcc ggcagcggcc      1380
     gggacgacgg cggctgccgg gctggtggaa cgggacagcg gtacggccga agcattggac      1440
     ggcgcacgta ccgtaccgat gcttcccacc agctggggca ccgattccga acacggccca      1500
     gacaggcccg ccgaaggggg gtccagcacc tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page