(data stored in ACNUC30630 zone)

EMBL: CU458896.PE443

CU458896.PE443       Location/Qualifiers
FT   CDS_pept        complement(449973..450638)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0447c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0447c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60546"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGL2"
FT                   /protein_id="CAM60546.1"
FT                   /translation="MIQDWHPTDPVVARLRFEVLTACGVDDPYDHSFYEPEVVAEHLGR
FT                   WFRRVVPDMLVAADYDAIERQGVFLTHYEGGGMYSWDGAVQKAFPEFPYQGHDHRWRIE
FT                   DVPEVLLRGMHLYSEAFGRLANSLGIKSIRVWRRLRADRAAQQIEHRVKPVSSVSWNRA
FT                   HMIRHDEDDPAYVLMVADVDPRVVVGVTVGRECHPVVTPFQIGRGPGHADVRWVVETA"
     ttgatccagg actggcatcc aaccgatccg gttgtggcga ggctgcgttt tgaggttctg        60
     acggcctgcg gcgtcgatga tccttatgat cattcgtttt acgaaccgga ggtggttgcc       120
     gagcatctgg gtcgctggtt tcggagggtc gttccggaca tgctggtggc ggccgactat       180
     gacgccatcg agcggcaggg tgtgtttttg acccactacg agggcggcgg gatgtacagc       240
     tgggatgggg ctgtgcagaa ggcatttccc gaatttccgt accaggggca tgatcaccgc       300
     tggcgcattg aggatgtccc cgaggtgctg ttgcgcggaa tgcacctgta cagcgaggct       360
     ttcgggcggc tggcaaattc gctgggaata aagtcaattc gggtgtggcg caggctccgc       420
     gccgatcgtg ccgcacagca gatcgagcat cgcgtcaagc cggtgtcctc ggtctcatgg       480
     aatcgtgccc acatgattcg ccacgatgag gacgaccccg catacgtgct gatggtggcc       540
     gatgtggatc cgcgtgttgt tgtcggtgtg accgtgggcc gcgaatgtca tccggtggtc       600
     acgccctttc agatcgggcg cggaccaggg cacgcagacg tgcgttgggt ggtggagacg       660
     gcctaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page