(data stored in ACNUC30630 zone)

EMBL: CU458896.PE451

CU458896.PE451       Location/Qualifiers
FT   CDS_pept        457447..457923
FT                   /transl_table=11
FT                   /locus_tag="MAB_0455"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60554"
FT                   /db_xref="GOA:B1MGM0"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGM0"
FT                   /protein_id="CAM60554.1"
FT                   /translation="MALTGDRARARSGRAAAARWVVPLTLLLTLAAALFPALRCSPALD
FT                   AHDPYGAGVSAARAAAAAQAVRAPQIAVHAMHSTAAQGVNVHSGCQLPAAVLATMAAAG
FT                   PGHGWWTLVVAATALLAAAAAAWVPASRGPPERGQLGSLCSGRARLHHFCVLRR"
     atggcgctca ccggcgatcg tgcccgcgcc cgcagcggcc gcgccgcggc ggcgcgatgg        60
     gtggtgccgt tgacgctgct gttgacactg gctgccgcac tcttcccggc gctgcggtgc       120
     tccccggcgc tcgatgcgca cgacccatac ggtgcgggtg tatcggcggc gcgcgccgcg       180
     gcggcggccc aggccgtgcg ggccccgcag atcgcggtac acgcgatgca cagcaccgcg       240
     gcacagggcg tgaatgttca ctccgggtgc cagctgccgg cggcggtcct tgcgaccatg       300
     gccgccgccg gccccggcca cgggtggtgg accctggtgg ttgcggccac cgcactgctg       360
     gctgctgccg ccgcggcatg ggtgcccgcc tcgcgcggac cacccgagcg tggccaactc       420
     ggctctttgt gcagtggacg tgcacgtttg caccatttct gcgtgctgcg gcgctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page