(data stored in ACNUC30630 zone)

EMBL: CU458896.PE461

CU458896.PE461       Location/Qualifiers
FT   CDS_pept        464652..464993
FT                   /transl_table=11
FT                   /locus_tag="MAB_0465"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60564"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGN0"
FT                   /protein_id="CAM60564.1"
FT                   /translation="MNNILRGRVTGLAVAASAVTAAVTVLLAPAAHAGPGGLGDADDVI
FT                   NSLKAQGNKVIVTKTGNKPMPQCVATRVRKDLDVYGGTPSTNCPNCNGASRRNQVVRLY
FT                   SVYHVDIQC"
     atgaacaaca ttttgcgcgg ccgtgtcacg ggattggccg tggccgctag tgccgtaacc        60
     gctgctgtga cagtgctgtt ggctccggcc gctcatgccg ggcctggtgg tctcggggac       120
     gccgatgatg tcattaacag tcttaaagcc cagggcaaca aggttattgt caccaagact       180
     ggcaacaagc cgatgccgca atgtgtggcc acccgggtcc gcaaggacct ggatgtctac       240
     ggcggtaccc cttcgacgaa ctgtcccaac tgcaatgggg catcgcgccg aaatcaagtt       300
     gtgcggctct acagcgttta ccacgtggac attcagtgct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page