(data stored in ACNUC30630 zone)

EMBL: CU458896.PE473

CU458896.PE473       Location/Qualifiers
FT   CDS_pept        472009..472470
FT                   /transl_table=11
FT                   /locus_tag="MAB_0477"
FT                   /product="Probable membrane protein, MmpS"
FT                   /note="Similar to Q73V84_MYCPA 3e-15"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60576"
FT                   /db_xref="GOA:B1MGP2"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGP2"
FT                   /protein_id="CAM60576.1"
FT                   /translation="MSRRKRSKGQAGRILGALWMPLVAVIVIAVVGFGVNRIREKSQAI
FT                   SHPPTTRPIPATVVQINPKNVTYEVFGNLGTSGKVSYANLNSEPVDVVLTSLPWSVSET
FT                   TMSSAASLSLVAQVDGDSLGCRIRVNGEVREEQVVNHTGAAVACTVTAA"
     atgagccgac gcaagcgatc aaaaggtcaa gccggccgaa ttctgggcgc gttgtggatg        60
     cccctggtgg cagtgatcgt catcgcggtc gtgggtttcg gggtcaaccg gattcgggag       120
     aagtcgcagg ccataagcca tccgccgacg acgcgtccga ttccggccac ggtggtccag       180
     atcaatccca agaacgtcac ctatgaggtg ttcggcaatc tgggaactag cgggaaagtg       240
     tcctatgcca atctcaatag cgaacccgtc gacgtcgtgc tgacgtcact gccatggtcg       300
     gtttcggaga ccacgatgtc gtcggcggct tcattgagcc tggtcgcaca ggtggatggg       360
     gattcgctgg gatgccgtat ccgcgtcaac ggtgaggtcc gtgaggaaca ggtcgtcaac       420
     cacaccggcg ccgcggtcgc atgcacggtg acggcagcat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page