(data stored in ACNUC30630 zone)

EMBL: CU458896.PE475

CU458896.PE475       Location/Qualifiers
FT   CDS_pept        475516..475956
FT                   /transl_table=11
FT                   /locus_tag="MAB_0479"
FT                   /product="Putative regulatory protein, MarR"
FT                   /note="Similar to Q43WJ6_SOLUS 6e-18"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60578"
FT                   /db_xref="GOA:B1MGP4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGP4"
FT                   /protein_id="CAM60578.1"
FT                   /translation="MVTDAVDEIVSNCLAVRVRLLGRAITSVYDHALEGHGVSIAQINL
FT                   MAALGRIGPCSPARIGEVLQLERSTVSRNVGLLIRRGWVEAVASDAKGVREVALTSSGG
FT                   EKIETVMPEWRRAQEEAALILGSGGIKSVRTLAANFGLPSGD"
     atggtcactg acgccgtcga tgagatcgtg agcaactgcc tggcggttcg ggtccggctg        60
     ctcggccggg ccatcacgag tgtctatgac cacgccctcg agggtcatgg tgtgagcatt       120
     gcccagatca atctgatggc cgctctgggc aggatcggcc cctgctcacc ggcgcgcatc       180
     ggcgaggttt tacagctgga gcggtcgacg gtcagtcgca acgtgggtct gttgatcagg       240
     cgcggttggg tggaggccgt ggcatcggat gccaagggag tccgcgaggt agcgctgacc       300
     tcgtcggggg gcgaaaagat cgagaccgtg atgcccgagt ggcggcgagc gcaggaagag       360
     gccgccctga tcctcgggtc cggtggtatc aaatccgtcc ggactctggc ggccaatttc       420
     ggactaccgt ccggcgatta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page