(data stored in ACNUC30630 zone)

EMBL: CU458896.PE477

CU458896.PE477       Location/Qualifiers
FT   CDS_pept        complement(477131..477499)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0481c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5YX72_NOCFA 8e-26"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0481c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60580"
FT                   /db_xref="GOA:B1MGP6"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGP6"
FT                   /protein_id="CAM60580.1"
FT                   /translation="MSIVVRIGLAELALGALLGWVVAANFLAPQLLRRAGVTNGRRFLQ
FT                   AHLDYIIMGILLIAVGLAVPDLPGWLAAVVVYGALLNPTLFLPMAFKQNVTSNTSFKVA
FT                   TFTSFVAMSGSLVLVAVQ"
     atgagcatcg tcgtccgcat cgggttggcc gagctggctc tcggcgcgct cttgggatgg        60
     gtagtagcag ccaactttct tgcgccacaa ttactcagga gggctggcgt gacaaatggg       120
     cgcaggtttc tgcaggccca tctcgactac atcatcatgg ggatactgct gatcgcggtg       180
     ggccttgcgg tacccgatct gcccggttgg ctggccgccg tggtggtcta tggcgcgctc       240
     ctgaacccca ccttgttcct tccgatggcg ttcaagcaga acgtcacctc caacaccagt       300
     ttcaaggttg ccaccttcac ctcattcgtg gcgatgagcg gcagcctggt actggtcgcg       360
     gtccaatag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page