(data stored in ACNUC30630 zone)

EMBL: CU458896.PE49

CU458896.PE49        Location/Qualifiers
FT   CDS_pept        48005..48460
FT                   /transl_table=11
FT                   /locus_tag="MAB_0052"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5YQ40_NOCFA 2e-21"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60152"
FT                   /db_xref="GOA:B1ME88"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME88"
FT                   /protein_id="CAM60152.1"
FT                   /translation="MTRARTPDWVLGAGARAMETSHRLLLAATGGRLGQRFGSNHTVEL
FT                   HVAGRKTGRRISTLLTSPVYAPDRLVLVASKGGSSDHPDWYKNLVANPTVEITADGATR
FT                   QYHTRTASAQEKARLWPSIVKSFPGYDGYQRNTDRQIPVVICELTTG"
     atgacccgcg cgcgtacccc cgactgggtg ttgggagcgg gagcccgggc catggaaacc        60
     agccatcggt tgctcctcgc ggcaacggga gggcggctgg ggcagcgatt cgggagcaac       120
     cacaccgttg aattgcatgt cgccgggcgg aaaacgggtc gccgcatctc gacgctgctg       180
     acctcgcccg tctatgcgcc cgatcggttg gtgctggttg cctcaaaagg tggatcgtcg       240
     gatcaccccg actggtacaa gaatctcgtg gccaacccga ccgtcgagat cacggcggac       300
     ggcgccactc ggcagtatca cacgcgtacc gcctctgcgc aggagaaagc caggttatgg       360
     ccgagcatcg tcaagtcgtt ccccggttac gacggatacc agcgcaatac cgataggcaa       420
     atcccggtcg tgatttgtga attgacgacc ggctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page