(data stored in ACNUC30630 zone)

EMBL: CU458896.PE490

CU458896.PE490       Location/Qualifiers
FT   CDS_pept        492892..494049
FT                   /transl_table=11
FT                   /locus_tag="MAB_0494"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25ZD6_MYCVN 4e-07"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60593"
FT                   /db_xref="GOA:B1MGQ9"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGQ9"
FT                   /protein_id="CAM60593.1"
FT                   /translation="MSAAAEAWGNLQAIRVAVLVGFMPVLLYRIWRVARFPASVPALAA
FT                   TAFGASAWFWLLIYSDWVWPSLPPVVHAVSVAGWPPITIAACLQVFVVGIAGDASPARI
FT                   RRALRTASVMAVLALIAVTVLVTRSRLPMSSDDVYVLAEAVFTEGDPAAVTAVVISSAY
FT                   VIFVAVQLAWHGFRHIDRTPVGVGLGLMAVASIFQIVACVFGGIWQPLSRGQGVMGSAY
FT                   GVWLDTWPGCIAEILMFTGFLWPPVVSRVQAHRDVRRLRPLHNALADLFPALFPPMESR
FT                   IRLSDKVFEWGFHIQDGLTLLAQRRGDPLVAGRPAAEESSARAGVVAKWLVGQPVPGFS
FT                   REWLHAPDGVSDESWMLAIADAYRERQEDAEFPASLSGMPSTLRR"
     gtgagtgccg ccgcagaggc atgggggaac ctgcaagcca tccgggtggc ggtgctggtt        60
     ggcttcatgc cggtattgct ctaccggatc tggcgagtcg cgcgattccc ggcgtctgtg       120
     ccggcccttg ccgcaacggc tttcggagca tcggcctggt tctggctcct gatttactcc       180
     gactgggtgt ggccctcgtt gccgcccgtg gtgcacgctg tcagcgtggc gggctggccg       240
     cccatcacga tcgctgcctg tttgcaggtc tttgtggtgg gcatcgccgg ggatgcgtcg       300
     ccggcgcgga tccgacgtgc gttacgtacg gcttccgtga tggctgttct cgcgctgata       360
     gcggtcacgg tgctggtaac ccgcagtcgg ctgcccatga gctcagatga cgtgtacgtg       420
     cttgccgagg cggtcttcac cgagggcgat ccggcagcgg tcacggcggt ggtgatcagc       480
     agcgcgtacg tgatattcgt ggcggtccag ttggcgtggc atggttttcg acacatcgac       540
     cgcaccccgg tcggggtcgg tctagggctg atggcggtgg cgtccatctt tcagattgtt       600
     gcgtgcgtct tcgggggtat ctggcagccg ctgtcgcgcg gccaaggggt tatgggtagt       660
     gcgtatggag tgtggctcga tacctggccg ggctgcatcg cggagatctt gatgttcacg       720
     ggattcctgt ggcctcccgt ggtatcgcgc gtgcaggcgc atcgggacgt acggcggctt       780
     cgtccgctgc acaacgccct cgcggatctc tttccggcgc tttttccgcc aatggaatcg       840
     cgcataaggt tgtccgacaa ggtgtttgaa tggggcttcc atattcagga tggtcttacc       900
     ttgctggcac aacggcgcgg tgacccgctt gtggccgggc gcccggctgc cgaagagtca       960
     tcagcgcggg cgggggtagt ggcaaaatgg cttgtcggcc aaccagttcc ggggttcagc      1020
     cgtgaatggc tgcacgcccc tgatggcgtc agtgacgaat cctggatgct cgcgatagcc      1080
     gacgcctatc gggagcgtca ggaagacgcg gagttcccgg cttccttgtc gggtatgccc      1140
     tccaccttgc ggaggtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page