(data stored in ACNUC30630 zone)

EMBL: CU458896.PE491

CU458896.PE491       Location/Qualifiers
FT   CDS_pept        complement(493989..494411)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0495c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q7TVI6_MYCBO 5e-29"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0495c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60594"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGR0"
FT                   /protein_id="CAM60594.1"
FT                   /translation="MPDFSKRLSHLFATVHPAGRGPYSLNEVVAALGKRGVEVSSPYLS
FT                   LLRKGERSNPAPEIVTALAEFFQVSPAYFYDADYAESVNRDLDWLVQLRDSKVREIAQR
FT                   SYALSEHSRQAIADMVDHLRKVEGIPDKEAGNSASS"
     atgccggact tttcgaaacg actgagccat ctgtttgcca cggtgcatcc ggcagggcgt        60
     ggcccgtact cactgaacga agtggtagct gctctcggta agcgcggtgt cgaggtgtcc       120
     tcaccgtacc tatcactcct gcgcaagggc gagcgttcca accccgcacc ggaaatcgtc       180
     acggcgctgg cggagttctt ccaagtgagc cccgcctact tctatgacgc cgactatgcc       240
     gaatcggtca accgcgacct ggattggctt gtgcagctgc gcgactcgaa ggtacgagag       300
     atagcgcagc gcagctacgc attatccgag cacagccggc aggcgattgc cgacatggtc       360
     gatcacctcc gcaaggtgga gggcataccc gacaaggaag ccgggaactc cgcgtcttcc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page