(data stored in ACNUC30630 zone)

EMBL: CU458896.PE494

CU458896.PE494       Location/Qualifiers
FT   CDS_pept        complement(496272..496706)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0498c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25WA0_MYCVN 2e-24"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0498c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60597"
FT                   /db_xref="GOA:B1MGR3"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGR3"
FT                   /protein_id="CAM60597.1"
FT                   /translation="MAPLIALVVGTLSARLAGILGLAPADSWPAAVAVGLAAMFTLTGI
FT                   AHFVPKMRDAMIAIVPPRIPAPGFLVALTGALELLGAAGVLIPATRVVAAASLAALLVA
FT                   MFPANVYAASQRSNPLSTPLGWRTLEQLLFLAAAATAACG"
     atggctccgc tcatcgccct tgtggtcgga accctgtcgg cgcggctagc cggcattctg        60
     ggactcgcac ccgccgactc ctggcccgcc gccgtggcag tcggtctcgc cgccatgttc       120
     acgctgaccg gtatcgcgca tttcgtgccg aagatgcgtg atgccatgat cgcgatagtg       180
     ccgccgcgga tcccggcgcc cgggttcttg gtggcgctga caggggctct tgagctgctc       240
     ggcgcggccg gcgtgctgat tcccgcaacc agagtggtgg cggcggcgag tctggccgcc       300
     ctgttggtgg cgatgtttcc cgccaatgtg tatgccgcga gccagcggtc caatccgctg       360
     tcgactccgc tgggatggag gacccttgag caattgctct tcctcgcggc ggcggcaacc       420
     gccgcatgcg gctag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page