(data stored in ACNUC30630 zone)

EMBL: CU458896.PE512

CU458896.PE512       Location/Qualifiers
FT   CDS_pept        complement(517837..518358)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0516c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q278V8_MYCFV 2e-56"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0516c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60615"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGT1"
FT                   /protein_id="CAM60615.1"
FT                   /translation="MLMHQGIGRDTFNQMPDTRAVHALYECCGSVTWARKVAATRPFAD
FT                   HDALFRCADNELFALSEESLNEMLTAYPPLGKRPGSVRSHAEQCAIRDETPGMMAALRA
FT                   AAHRYEHHFGHRFVMHMCGQDGASVLRAISDRMHHDADTERKVTRNELAKINRTRLERM
FT                   LGPEGGYDNW"
     atgttgatgc atcagggcat cggccgcgac acgttcaatc agatgcccga tacccgagcc        60
     gtgcatgcgc tgtacgagtg ttgtggcagc gtgacatggg ccaggaaggt cgcagcgact       120
     cgtccattcg ccgaccacga tgcgctgttc cgatgcgcag acaacgaact gttcgcgctc       180
     tcagaggaat cgctgaacga gatgctgacc gcctatccgc cgctgggcaa acggccggga       240
     agcgtgcgtt cacacgccga gcagtgcgcg atccgcgatg agacaccggg catgatggct       300
     gcgttacggg ccgccgccca tcggtacgaa catcacttcg gccatcgttt cgtcatgcat       360
     atgtgcggac aggacggtgc atcggtattg cgggccatct ccgatcgcat gcatcacgac       420
     gcggacaccg aacgcaaggt gacccgcaat gaacttgcga agatcaaccg cacgcggctg       480
     gaacgcatgc tcggccccga gggcggttac gacaactggt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page