(data stored in ACNUC30630 zone)

EMBL: CU458896.PE534

CU458896.PE534       Location/Qualifiers
FT   CDS_pept        539102..539569
FT                   /transl_table=11
FT                   /locus_tag="MAB_0538"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25R50_MYCVN 4e-35"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60637"
FT                   /db_xref="GOA:B1MGV3"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGV3"
FT                   /protein_id="CAM60637.1"
FT                   /translation="MGTTRFRDLLVAGVVTAIFCYFFVSAAYGSLPPIPLLAGVSLLVL
FT                   AVAEAGWAFYVRNRVNDGQIGVGAGRLPALAVARSVVVAKASAWLGTLMTGWWMAMLVY
FT                   ILPRRAHLAAAAADTLGVVIATGCALALVVAGLWLQHCCKSPPDPPATPAR"
     gtgggaacca cccgcttccg cgatctgctg gtcgcgggcg tcgtcacggc gatcttttgc        60
     tatttctttg tttcggcggc ttacggatcc ctgccgccga ttcccctgct tgccggcgtc       120
     tcgctgctgg tgctggcggt cgcggaggcc ggctgggcgt tctacgtgcg taacagggtc       180
     aacgacggcc agatcggcgt gggcgcgggg cgtttgcctg cgttggccgt ggcgcgttcg       240
     gttgtggtcg cgaaggcttc ggcgtggctg ggcacgctga tgaccggatg gtggatggcg       300
     atgctcgttt acatcctgcc gcggcgcgca catctggccg ccgcggcggc cgacactctc       360
     ggcgtggtga tcgcgaccgg atgcgcgttg gcgctcgtcg tcgccgggct gtggcttcag       420
     cattgctgta agtcgccgcc ggacccgccc gcgacccccg cgagatag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page