(data stored in ACNUC30630 zone)

EMBL: CU458896.PE541

CU458896.PE541       Location/Qualifiers
FT   CDS_pept        546212..546556
FT                   /transl_table=11
FT                   /locus_tag="MAB_0545"
FT                   /product="Protein lsr2 precursor"
FT                   /note="Similar to Q278T6_MYCFV 1e-29"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60644"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGW0"
FT                   /protein_id="CAM60644.1"
FT                   /translation="MAKKVTVTLVDDVDGEAPADETVEFGVDGVTYEIDLSSKNAEKLR
FT                   NQLSTWVEHARRVSGRRRGRGSSGSGRGRASIDREQSAAIREWARKNGHNVSSRGRIPA
FT                   EVVDAFNAAN"
     atggctaaga aggtcacggt cacgcttgtc gacgacgtcg acggcgaagc gcctgccgac        60
     gagaccgttg aattcggtgt tgacggtgtg acttacgaga tcgacctttc ttctaagaat       120
     gcggagaagc tgcgtaatca gctctctaca tgggtcgagc acgcgcgtcg tgtgagcgga       180
     cgtcgtcgcg ggcgggggag ttcgggctcg ggtcgtggcc gtgccagcat cgatcgcgag       240
     cagagtgcgg cgatccgcga gtgggcacgt aagaacgggc acaatgtgtc ctcgcgtggc       300
     cgcattcccg ccgaagttgt cgacgcgttc aacgcggcca actag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page