(data stored in ACNUC30630 zone)

EMBL: CU458896.PE556

CU458896.PE556       Location/Qualifiers
FT   CDS_pept        562439..563185
FT                   /transl_table=11
FT                   /locus_tag="MAB_0561"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q7D583_MYCTU 1e-68"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60659"
FT                   /db_xref="GOA:B1MGX5"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGX5"
FT                   /protein_id="CAM60659.1"
FT                   /translation="MMDMHPSGPLPSEIYWRRRALAIGVVVVVVAIVAAVIFALVGGSA
FT                   GADTKAAEKPAESAAPAGKPVILPPNEINKPADKPAEAPVHDGPPIAKPELVPPVALNP
FT                   GDDCPDATLAVKASTDKPSYLAGEQPKFTMVVTNIGLVQCKRDVGAAVLAASVFSVDNK
FT                   RIWANLDCAPSQESSIKSFNPGEQVTTEVTWTGMGSAPNCPLPRPAIGPGTYSLVVQLG
FT                   DLRSAPVPFIIGEKPADAPPPAGPPA"
     gtgatggaca tgcacccttc aggcccgctg ccttctgaga tctattggcg gcgccgcgcg        60
     ctcgcgatcg gcgtggtggt ggtcgtggtc gccatcgttg cggcggtgat cttcgcgttg       120
     gtcggcggca gtgccggagc cgatacaaag gctgccgaga agcccgccga atccgccgcc       180
     cccgccggca agccggtcat cttgccgccc aatgagatca acaagcccgc cgacaaacca       240
     gcggaggctc cggttcatga cgggccgccg atcgccaagc cggagttggt gccgccggtg       300
     gcgctgaacc ccggggacga ctgccccgac gcgacgctcg cggtgaaggc ctcgaccgac       360
     aagcccagct acctggcggg tgagcagccc aagttcacca tggtggtcac caatatcggc       420
     ctggtgcaat gcaagcgcga tgtgggggca gcggtgttgg ccgcctccgt cttcagcgtg       480
     gacaacaagc ggatctgggc gaacttggac tgcgctccgt cacaggaatc gtcgatcaag       540
     agcttcaatc ccggtgagca ggtgaccacc gaggtcacct ggaccggaat gggttccgca       600
     cccaactgcc cgctgccacg cccggcaatc ggcccgggaa cttattcgtt ggtggtgcag       660
     cttggtgacc tacgcagtgc accagtgcct ttcatcatcg gcgagaagcc ggccgacgcg       720
     ccgccgccgg cagggccacc ggcctag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page