(data stored in ACNUC30630 zone)

EMBL: CU458896.PE559

CU458896.PE559       Location/Qualifiers
FT   CDS_pept        complement(564855..566276)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0564c"
FT                   /product="Probable DNA repair protein RadA"
FT                   /note="Similar to Q278S3_MYCFV e-172"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0564c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60662"
FT                   /db_xref="GOA:B1MGX8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGX8"
FT                   /protein_id="CAM60662.1"
FT                   /translation="MAKPRAQYRCSECQHTTAKWVGRCPDCGTWGSVSETAVLSSIGGL
FT                   GAVRAVAPASAAVPITSIATDTTRHQPTGVSELDRVLGGGLIPGSVNLLAGEPGVGKST
FT                   LLLKVVHQWAASGGRALYISGEESAAQVRLRAERTGCVHDEVYLASESDLHSVLGHIEA
FT                   VKPTLAIIDSVQTMSTTDADGVTGGVTQVRAVTTALTMAAKSSGVAMVLVGHVTKDGAI
FT                   AGPRSLEHLVDVVLHFEGDKHSALRMVRGIKNRFGAADEVGCFQLRDKGIECVSDPSGL
FT                   FLEHREKAAAGTAVTVTLDGKRPLLGEVQSLVTTSTNPSPRRAVSGLDHARSAMVTAVL
FT                   ERHGRLPLGNNDIYMATVGGMRMTDPSADLAILMAVASAYTDIALPANMVFIGEVGLAG
FT                   DIRRTAAVGKRISEAARLGYTHAVIPPEGDDLHPAGMHLLRCPTVGRALEVLSEARKIE
FT                   PEKRPNLRLAQQFTD"
     gtggccaaac cccgcgcgca atatcgctgt tcggaatgtc agcacaccac cgccaaatgg        60
     gttggtcgct gccccgactg cggcacctgg ggcagcgtca gcgaaaccgc ggtgttgtcc       120
     tccatcggcg gtctgggcgc ggttcgcgcg gtagcgccag cctcggcggc ggtgccgatc       180
     accagcatcg cgaccgatac cacccggcat cagcccaccg gcgtctccga gctggacaga       240
     gtgctcggtg gcggcctcat ccccggctcg gtcaatctgc tcgccggcga gccgggagtc       300
     gggaagtcaa ccctgctgtt gaaggtcgtc catcaatggg ccgcctccgg cgggcgagcc       360
     ctgtacatca gcggtgagga gtccgcggct caggtccggt tgcgggccga acgcaccggc       420
     tgcgtgcacg acgaggtcta cctggcttcg gaatcggacc tgcacagcgt gctcggacac       480
     atcgaggcag tcaaacccac actggcgatt attgattcgg tacagaccat gtccacgacc       540
     gacgccgacg gcgtaaccgg cggtgtgact caggtgcgcg cggtgactac ggcactgacc       600
     atggccgcca agtcgtcggg tgtggcaatg gtgttggtcg ggcatgtcac caaggacggc       660
     gcaatcgccg gcccgcggtc actggaacat ctcgtcgatg tggtgttgca tttcgagggc       720
     gacaaacatt ccgcgttgcg gatggtgcgc ggtatcaaga atcgattcgg tgccgcggac       780
     gaagtcggtt gctttcagct acgggacaag ggaatcgagt gtgtttccga cccctctggg       840
     ctttttctgg agcatcgcga gaaggcggcg gccggtaccg cggtgacagt caccctcgac       900
     ggcaagcggc cactgctcgg tgaggtgcaa tcccttgtca ccacgtcgac caacccatca       960
     ccccggcgtg cggtgagcgg cctcgatcac gcacgctcgg cgatggtcac cgccgtgctg      1020
     gaacggcatg ggcgacttcc cttgggaaac aacgatatct acatggcgac agtgggcggc      1080
     atgcgcatga ccgacccgtc ggccgatcta gccattctga tggcagtggc atccgcgtac      1140
     accgatatag cgttacccgc caatatggtt ttcatcggcg aggttgggct ggcgggcgat      1200
     atccgccgca ccgccgccgt gggcaagcgc atctccgagg ccgcccggct cggctacacg      1260
     cacgcggtga ttccccccga aggcgacgac ctgcaccccg ccggtatgca cctgctgcgt      1320
     tgcccgacgg tgggcagggc cctcgaagtg ctctccgaag cacgcaagat cgaaccggaa      1380
     aagcgcccaa atctgcgctt ggcgcaacaa tttacggact ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page