(data stored in ACNUC30630 zone)

EMBL: CU458896.PE57

CU458896.PE57        Location/Qualifiers
FT   CDS_pept        57232..57879
FT                   /transl_table=11
FT                   /locus_tag="MAB_0060"
FT                   /product="Possible nitrate/nitrite response transcriptional
FT                   regulatory protein NarL (LuxR family)"
FT                   /note="Similar to Q279C6_MYCFV 2e-84"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60160"
FT                   /db_xref="GOA:B1ME96"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME96"
FT                   /protein_id="CAM60160.1"
FT                   /translation="MQVSGELVRVVVGDDHPLFREGVVRALTASGQITVVAEAENGTGA
FT                   LELIREHRPDVALVDYRMPELDGTQVAAAVRRDELPTRVLLLSAHDDAAIVYRALEEGA
FT                   AGFLSKESTRTELVGAVLDCARGRDVVAASLTAGLAGEIRKRAQPAGPSLSTREREVLR
FT                   MIAAGQTVPAIARALFLAPSTVKTHVQRLYEKLGVGDRAAAVAEAMRRGLLE"
     atgcaggtga gcggcgaact tgtgcgggtc gtcgtcgggg acgatcaccc cctcttccgg        60
     gagggcgtgg tgcgggcgct cacggccagc gggcagatca ccgtggtcgc ggaggctgag       120
     aacggcaccg gcgcgctgga actgatcagg gagcaccggc ccgatgtcgc gttggtggac       180
     taccgaatgc cggagttgga cggcacccag gtggcagccg cggtacgccg tgacgaacta       240
     cccaccaggg tgctgctgct ctcggcacac gacgacgcgg ccattgtgta tcgcgcattg       300
     gaggaagggg cggccggatt tctgtcgaag gaatccactc ggactgagct ggtcggcgcc       360
     gtgctcgact gcgcgcgggg acgcgacgtg gtggcggcaa gcctgacggc ggggctggcc       420
     ggcgagatcc gcaagcgggc acaaccggcg gggccctcac tgagtacccg cgaacgtgag       480
     gtgctcagga tgattgccgc cgggcagacg gtgccggcga ttgccagggc gctgtttctg       540
     gctccctcca cggtgaagac tcatgtgcag cgcctgtacg agaagctcgg tgtcggcgac       600
     cgtgccgcgg cggtggcaga agcgatgcgc cgcggcttgc tggaatag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page