(data stored in ACNUC30630 zone)

EMBL: CU458896.PE576

CU458896.PE576       Location/Qualifiers
FT   CDS_pept        complement(582445..582744)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0581c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q741U3_MYCPA 5e-14"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0581c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60679"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGZ5"
FT                   /protein_id="CAM60679.1"
FT                   /translation="MAAGTRSLRTDLRYLLVLHIHRHGLTTVSELVTMLADIGFDLDGR
FT                   PSKTVSDTLRTDVKLDRVRRRGRGLYSPGALPRSTQHRMRARTDKWSRLARQAE"
     atggctgccg gcacacgctc gctacgcacc gatctacgct atctgctggt actgcatatc        60
     caccgtcatg ggctcaccac ggtgtccgag ctcgtcacca tgttggccga cattggattt       120
     gacctagacg ggcggccgtc gaagacggtt tcggacaccc tgcgcaccga cgtcaaactc       180
     gaccgcgtcc gacggcgcgg gcgcggactc tacagtcccg gggcgttgcc gcgaagcacc       240
     caacaccgta tgcgcgcccg aaccgacaag tggtcgcggc tagcgcggca agccgagtag       300
//

If you have problems or comments...

PBIL Back to PBIL home page