(data stored in ACNUC30630 zone)

EMBL: CU458896.PE58

CU458896.PE58        Location/Qualifiers
FT   CDS_pept        57885..59072
FT                   /transl_table=11
FT                   /locus_tag="MAB_0061"
FT                   /product="Possible two component sensor kinase"
FT                   /note="Similar to Q279C5_MYCFV 8e-88"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60161"
FT                   /db_xref="GOA:B1ME97"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME97"
FT                   /protein_id="CAM60161.1"
FT                   /translation="MTRLDNMADYFAAEPMRVSAWLRLPLIGLIVLLGSDPNIQMWHNG
FT                   VYYGVLAAYTLSAVVWVGIAVRGQVADWVAPAATSADIAAVVMLCLASGAGNTELLPVF
FT                   FLLPVSVAFQERPAITAILGIITAVAYFGILVYYIADGNLERIPGDEYVTWAALLWLTV
FT                   FTTGMCFVLKRRSARVVQLVHIREQLVLESMRADERRNREVAERLHDGPLQNLLAARLR
FT                   IEEVLERQSDPVLTAVHSSLRETAAELRGAVSSLHPQVLIELGLTAAIRELARQHTARG
FT                   IVDVSTAVEEVGSPPAQPLVYRAAKELLTNAVKHGRAKNIRVELSSRRCWLTLVVTDDG
FT                   RGFDPRDLVLSVADGHIGLASLTVPIEAAGGAVTITSAPGAGTRVSVTAPADMAA"
     atgacccggc tggataacat ggccgactat ttcgccgctg aacccatgcg ggtgtcggcc        60
     tggctgcggc tgccgcttat cgggttgata gtgctgctgg gttcagatcc gaatattcag       120
     atgtggcaca acggcgtcta ctacggggtg ctggccgcgt acacgctgtc ggccgtcgta       180
     tgggtgggga tcgcggtacg cggacaggtt gccgattggg ttgctcccgc agccacttcg       240
     gcagatatcg ccgccgtggt gatgctgtgc ctggcatccg gcgcaggcaa caccgagttg       300
     ctgccggtgt tcttcctgct ccccgtgtcg gtggctttcc aggaacggcc cgctatcacg       360
     gcaattctcg ggatcatcac ggccgtagca tatttcggca tacttgtgta ctacatcgcc       420
     gatggcaatc tggagaggat tccgggcgac gagtacgtga cctgggcggc gctactgtgg       480
     ttgaccgtct tcacgacagg tatgtgcttt gtgctcaaac gccgttccgc gcgcgtcgtc       540
     cagctggtgc acatacgtga gcagttggtc ctggaatcga tgcgtgccga cgagcgccgc       600
     aatcgcgagg tggccgagcg gctgcacgat ggtccgctcc aaaatctgtt ggcggctcgt       660
     ctgcgcatcg aggaagtact tgaacgccag tcggatccgg tgctgacggc ggtgcactca       720
     tcgttgcgag agacggcggc cgagctacgc ggcgcggtgt cgtcgctgca tccgcaggtg       780
     ttgatcgagc tgggattgac ggcggcgatc cgggagctgg cgcgtcagca cacggcgcgt       840
     ggcatcgtcg acgtcagcac ggccgtcgag gaggtgggca gccccccggc gcaaccactg       900
     gtctaccgcg cggccaagga attgttgacc aatgctgtga aacacggcag ggccaagaac       960
     attcgggtgg agctcagctc gcgacggtgc tggctcaccc tcgtcgtcac ggatgacggc      1020
     cggggcttcg acccgcgtga tctcgtgctc tcggttgccg atgggcatat cggcctggcc      1080
     tcgctgaccg ttcccatcga ggccgccggt ggcgcagtca cgatcacctc ggcgccgggc      1140
     gccggtaccc gggtgtccgt cacggcgccg gccgatatgg cagcgtag                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page