(data stored in ACNUC30630 zone)

EMBL: CU458896.PE612

CU458896.PE612       Location/Qualifiers
FT   CDS_pept        616318..616710
FT                   /transl_table=11
FT                   /locus_tag="MAB_0617"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q743R5_MYCPA 8e-42"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60715"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1MH31"
FT                   /protein_id="CAM60715.1"
FT                   /translation="MTTVGEKLPELKLEGTPTFIVSTALATRDFQDVHHDRDLAQAKGS
FT                   KDIFINILSDTGLVERFVTDWAGPAARVKSISLRLGVPWYAYDTTVFTGEVAAVEDGVV
FT                   EVDVVGNNSLGAHVTAKVKLTIGAEQ"
     gtgaccactg ttggagagaa gctgcccgag ctgaaactcg aaggcacgcc cacgttcatc        60
     gtgtcgacag cgttggcgac gcgcgatttt caggacgtcc atcacgaccg ggacctggcg       120
     caggccaagg gatccaagga catcttcatc aacatcctgt ccgatacggg cctggtggag       180
     aggttcgtga ccgactgggc gggccccgcc gctcgcgtga aatcgatttc actgcgcttg       240
     ggggtgccgt ggtatgccta cgacaccacg gtgttcaccg gtgaggtggc cgctgtcgaa       300
     gacggtgtgg tggaagtgga tgtggtgggc aacaacagcc ttggcgcaca tgtgaccgcc       360
     aaagtgaagc tgacgatcgg agccgaacag tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page