(data stored in ACNUC30630 zone)

EMBL: CU458896.PE613

CU458896.PE613       Location/Qualifiers
FT   CDS_pept        616707..617870
FT                   /transl_table=11
FT                   /locus_tag="MAB_0618"
FT                   /product="Probable lipid transfer protein or keto acyl-CoA
FT                   thiolase Ltp2"
FT                   /note="Similar to Q25SF4_MYCVN e-178"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60716"
FT                   /db_xref="GOA:B1MH32"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B1MH32"
FT                   /protein_id="CAM60716.1"
FT                   /translation="MTGLSGRSAIAGIGATDFSKKSGRSELRLAAEAVLDALDDAGLSP
FT                   SDVDGLVTFTMDSNLETAVARATGIGELKFFSQIGYGGGAAAATVQQAALAVAAGVAEV
FT                   VVAYRAFNERSEFRFGQVMTGLSSTADSRGVEYSWSYPHGLSTPAASVAMIARRYMHEY
FT                   GATSADFGAVSVADRKHAATNPKAFFYGKPITIEDHQNSRMIADPVRLLDCCQESDGGV
FT                   AIVVTTPERAKDLKNRPVIIEAAAQGSGEDQFTMYSYYRDELGLPEMGLVGRQLWDQSG
FT                   LTPNDIQTAILYDHFTPYTLLQLEELGFCGKGEAKDFIANGAIELGGKLPINTHGGQLG
FT                   EAYIHGMNGIAEGVRQLRGTSVNQVPNVEHVLVTAGTGVPTSGLILG"
     gtgaccgggc tatctggccg gagcgcgata gccggtatcg gggctaccga cttttcgaag        60
     aagtcgggtc gatccgagct ccggctggca gccgaggcgg tgctcgacgc cctcgatgac       120
     gcggggctgt ctccgtcgga cgtcgatggc ttggtgactt tcacgatgga ctccaacctc       180
     gagaccgctg tggcacgggc gacgggcatc ggagagctga agttcttcag ccagatcggc       240
     tatggcggcg gtgccgcggc cgcgaccgtg cagcaggccg ccctggcggt cgcggcgggg       300
     gtcgccgaag ttgttgtcgc gtaccgtgct ttcaacgagc gctcggaatt ccggttcggt       360
     caggtgatga ccggtctgag ctcgaccgca gactctcgcg gcgtcgagta cagctggtcg       420
     tatcctcacg ggctgagcac gccggcagcg tccgtcgcga tgatcgctcg gcgatacatg       480
     cacgaatatg gtgccacgag tgcggatttc ggtgcggtat cggtggccga ccgtaagcat       540
     gcggccacca accccaaggc gttcttctac ggcaagccga tcaccattga ggatcaccag       600
     aattcgcgga tgatcgccga cccggtgcga ctgctggact gctgccagga gagcgacggc       660
     ggggtggcga ttgtggtgac cacgccggag cgggccaagg atctcaagaa ccggccggtg       720
     atcattgagg ccgccgcgca ggggtccggc gaggaccagt tcaccatgta ctcgtactac       780
     cgcgacgagc tcggactacc cgagatgggt ctggtcggtc ggcagctgtg ggaccaatct       840
     gggttgaccc ccaacgatat tcagactgcc atcctgtatg accacttcac gccgtacacg       900
     ctgttgcaac tcgaagagct cggtttctgc ggtaagggtg aggccaagga tttcatcgcc       960
     aacggcgcga tagagctggg cggcaagctg cccatcaaca cccacggtgg tcagctcggt      1020
     gaggcctaca tccacggcat gaacggtatt gccgaaggtg tgcgccagct gcgtggcacg      1080
     tcggtcaacc aagtgccgaa cgtcgagcac gtcctcgtca ccgccggcac cggtgtgccg      1140
     acctccggtc tgatcctggg ataa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page