(data stored in ACNUC30630 zone)

EMBL: CU458896.PE614

CU458896.PE614       Location/Qualifiers
FT   CDS_pept        617949..618674
FT                   /transl_table=11
FT                   /locus_tag="MAB_0619"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60717"
FT                   /db_xref="UniProtKB/TrEMBL:B1MH33"
FT                   /protein_id="CAM60717.1"
FT                   /translation="MSYSERYRNGETVEVWRDLWQLGSRVREPRYLEDATEVAHTMAIR
FT                   ARRNIELIADRLVDSGFVAHTNGNERKSRVPFIPAGEDSRVFVAQLTEKLGPIPLTVAS
FT                   WIEFVGDVWLVGSHPRWLGIHQSDPLVVEFEGAYSGGHSVAYSYYEGEHEEWLKSGIGS
FT                   FQMDFAPDRLHKANISGDEPYGIFVPDAYADGTVNMGGRHMSFVSYLNWVFKAGGFPLG
FT                   DGADARALREWLGAGIREL"
     gtgagctact cggagaggta tcgcaatggc gagacggtcg aggtgtggcg tgatctgtgg        60
     cagttggggt ctcgtgttcg tgaacctcga tatctggaag atgccacaga ggttgcgcac       120
     acgatggcaa tacgcgcgcg acggaatatc gagttgatag cggatcggct cgttgacagc       180
     gggtttgttg ctcacaccaa cggcaatgag cggaagtcgc gagttccgtt catacctgct       240
     ggtgaagatt cgcgagtgtt cgtcgcgcag ctaacagaga aactcgggcc tattccgctc       300
     actgtggcgt cttggatcga gtttgtgggg gacgtatggc tggtgggtag ccacccacgt       360
     tggctgggca tccaccagtc tgaccctctg gtagtcgagt tcgagggcgc gtattcgggc       420
     ggccactcgg tggcttactc atactacgag ggcgagcacg aggagtggtt gaagagcggg       480
     attggttcgt ttcaaatgga tttcgcccca gatcggctac acaaggccaa cattagtggc       540
     gatgagccgt atgggatctt cgtacctgac gcctacgcag atggcactgt caacatgggc       600
     ggccggcaca tgagcttcgt ttcctatctc aactgggtct tcaaagccgg cgggttcccc       660
     ttaggggacg gggcagatgc gcgggcgctt cgtgagtggt taggcgctgg catccgggag       720
     ctataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page