(data stored in ACNUC30630 zone)

EMBL: CU458896.PE647

CU458896.PE647       Location/Qualifiers
FT   CDS_pept        655298..656521
FT                   /transl_table=11
FT                   /locus_tag="MAB_0652"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60750"
FT                   /db_xref="GOA:B1MHS8"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHS8"
FT                   /protein_id="CAM60750.1"
FT                   /translation="MTQPPQFGGPNPIDGPANPAPQYDGPQFGGPAPVGAPQPDPHGPP
FT                   PNFVQSPQQPGWPNQFGGQPQQYQQFGQPPAAPQQNRKALIVTGVATGVVLLVVAVVVG
FT                   IVSFSGGGDGETRPAGGAATAEAAVKGYLEALSKGDAEAALSYSADQPASKEFLTDDIL
FT                   KKQIAQWPVGNIRILNSEDMGGVMARVHVAANFGDQTSDETILVKKTDGSWKLSTAAVK
FT                   LSLDQNGILAGALRTLSLFGKPASNMSVAYVFPGWLDIGSANKNLTAVSARPVLLNGIL
FT                   VQGAPVFPGIEMRMSEEGAAAVKKAVADNIAECAKSTSLAPPGCPQALRNPAYVDGTAR
FT                   WEPPSDVDKVQYTFTAFDLTVRTTGVTTWMLTVQSTNGSTVQGRAIVPTMGQIDMTQDP
FT                   LIVKWFGR"
     gtgacgcagc cgccgcagtt cggcggcccc aatcccattg acggaccggc caaccccgcg        60
     ccgcagtacg acggcccgca attcgggggc ccggcacccg tgggtgcgcc gcagccagat       120
     ccccacggcc cgcctcctaa ctttgttcag tctccccagc agcccggttg gcccaaccag       180
     ttcggcggtc agccgcagca gtatcagcag tttgggcaac caccggccgc gccgcagcag       240
     aaccgcaagg cactgattgt caccggggtg gctaccggtg tggtgctgct ggtggtggcc       300
     gttgtggtgg gaatcgtgtc gttttccggt ggcggcgacg gcgagacgcg gcccgccggc       360
     ggcgcggcga ccgccgaggc cgcggtaaag ggatacttgg aggcactgtc caagggcgat       420
     gccgaagcgg cgctttccta ttcggcggat cagccggcgt ccaaggaatt tctgaccgac       480
     gacatcctga agaagcagat cgcacagtgg ccggtcggga acatccggat tctcaattcc       540
     gaggatatgg gtggcgtgat ggcacgtgta catgtagccg cgaacttcgg cgatcaaact       600
     tccgacgaga caattcttgt caagaagacg gacggatcct ggaagctcag caccgcggcg       660
     gtcaaactgt cacttgacca gaacggtatc ctggccggcg ccctccgtac gctgtcgctg       720
     tttggcaagc ccgcctcgaa tatgtctgtc gcatacgtat ttccgggttg gttggatatc       780
     ggctcggcca acaagaatct gacggcggtc tcggcgcgcc cggttctgct caacgggatc       840
     ctggtgcagg gtgccccggt atttccgggg atcgagatgc ggatgagcga agagggcgcc       900
     gcggcggtga agaaggccgt ggcggacaac attgccgaat gtgcgaaatc tacgtcgctg       960
     gcgccgccgg gatgccctca ggcactgcgt aacccggcct atgttgacgg tacggctcgc      1020
     tgggagccgc catcggacgt ggacaaggtg caatacacat ttaccgcgtt cgacctgacg      1080
     gtgcggacca ccggcgtaac cacgtggatg cttactgtgc agtccaccaa cggcagcacc      1140
     gtgcaaggga gggcgattgt gccgacgatg gggcaaatcg atatgacaca ggatccgctg      1200
     atagtgaagt ggttcggccg gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page